Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6151
Gene name
LocationContig_312:835..5171
Strand-
Gene length (bp)4336
Transcript length (bp)4191
Coding sequence length (bp)4191
Protein length (aa) 1397

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 7.2E-41 1042 1223
PF00122 E1-E2_ATPase E1-E2 ATPase 4.4E-34 378 589
PF13246 Cation_ATPase Cation transport ATPase (P-type) 1.3E-22 689 779
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 5.2E-20 607 969
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 2.0E-05 275 320
PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase 2.9E-05 941 1002

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 201 1224 0.0E+00
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 224 1224 0.0E+00
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 258 1224 0.0E+00
sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 280 1224 0.0E+00
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 280 1327 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 201 1224 0.0E+00
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 224 1224 0.0E+00
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 258 1224 0.0E+00
sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 280 1224 0.0E+00
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 280 1327 0.0E+00
sp|Q9R0K7|AT2B2_MOUSE Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus GN=Atp2b2 PE=1 SV=2 280 1226 0.0E+00
sp|Q64568|AT2B3_RAT Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 280 1231 0.0E+00
sp|Q65X71|ACA6_ORYSJ Probable calcium-transporting ATPase 6, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os05g0495600 PE=3 SV=1 280 1224 0.0E+00
sp|Q2QY12|ACA4_ORYSJ Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1 245 1224 0.0E+00
sp|Q64542|AT2B4_RAT Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 280 1241 0.0E+00
sp|P23634|AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2 280 1241 0.0E+00
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 280 1224 0.0E+00
sp|Q2QMX9|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1 245 1224 0.0E+00
sp|Q37145|ACA1_ARATH Calcium-transporting ATPase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=3 250 1224 0.0E+00
sp|O81108|ACA2_ARATH Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1 280 1224 0.0E+00
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 188 1224 0.0E+00
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 174 1224 0.0E+00
sp|D3K0R6|AT2B4_BOVIN Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 280 1241 0.0E+00
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 278 1224 0.0E+00
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 280 1241 0.0E+00
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 280 1241 0.0E+00
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 280 1241 0.0E+00
sp|Q8RUN1|ACA3_ORYSJ Calcium-transporting ATPase 3, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os01g0939100 PE=2 SV=1 274 1224 0.0E+00
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 280 1241 0.0E+00
sp|Q6Q477|AT2B4_MOUSE Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus GN=Atp2b4 PE=1 SV=1 280 1241 0.0E+00
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 280 1226 0.0E+00
sp|Q6ATV4|ACA2_ORYSJ Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1 275 1223 0.0E+00
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 182 1307 0.0E+00
sp|P38929|ATC2_YEAST Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 183 1246 0.0E+00
sp|Q9LY77|ACA12_ARATH Calcium-transporting ATPase 12, plasma membrane-type OS=Arabidopsis thaliana GN=ACA12 PE=2 SV=1 182 1226 2.0E-176
sp|Q9LIK7|ACA13_ARATH Putative calcium-transporting ATPase 13, plasma membrane-type OS=Arabidopsis thaliana GN=ACA13 PE=3 SV=1 275 1224 4.0E-170
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 499 1226 3.0E-164
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 499 1226 5.0E-163
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 499 1226 2.0E-159
sp|Q73E41|BACA1_BACC1 Calcium-transporting ATPase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0519 PE=1 SV=1 279 1222 3.0E-103
sp|P13586|ATC1_YEAST Calcium-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMR1 PE=1 SV=1 279 1186 5.0E-101
sp|P37278|ATCL_SYNE7 Calcium-transporting ATPase OS=Synechococcus elongatus (strain PCC 7942) GN=pacL PE=1 SV=2 279 1211 5.0E-101
sp|Q9CFU9|LLCA1_LACLA Calcium-transporting ATPase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yoaB PE=1 SV=1 287 1095 1.0E-96
sp|O34431|ATCL_BACSU Calcium-transporting ATPase OS=Bacillus subtilis (strain 168) GN=yloB PE=1 SV=1 287 1163 2.0E-95
sp|Q9XES1|ECA4_ARATH Calcium-transporting ATPase 4, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA4 PE=2 SV=2 267 1110 5.0E-91
sp|Q8Y8Q5|LMCA1_LISMO Calcium-transporting ATPase lmo0841 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0841 PE=1 SV=1 280 1078 3.0E-90
sp|P92939|ECA1_ARATH Calcium-transporting ATPase 1, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA1 PE=1 SV=2 267 1110 5.0E-90
sp|Q42883|ECAP_SOLLC Calcium-transporting ATPase, endoplasmic reticulum-type OS=Solanum lycopersicum GN=LCA1 PE=2 SV=1 287 1123 4.0E-88
sp|Q9YGL9|AT2A3_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Gallus gallus GN=ATP2A3 PE=2 SV=1 287 1100 4.0E-87
sp|O43108|ATC1_YARLI Calcium-transporting ATPase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PMR1 PE=3 SV=1 280 1186 8.0E-86
sp|Q64518|AT2A3_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Mus musculus GN=Atp2a3 PE=1 SV=3 287 1100 4.0E-85
sp|Q93084|AT2A3_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Homo sapiens GN=ATP2A3 PE=1 SV=2 287 1100 8.0E-85
sp|O23087|ECA2_ARATH Calcium-transporting ATPase 2, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA2 PE=1 SV=1 280 1110 8.0E-85
sp|P18596|AT2A3_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Rattus norvegicus GN=Atp2a3 PE=1 SV=2 287 1100 1.0E-84
sp|P70083|AT2A1_MAKNI Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Makaira nigricans GN=atp2a1 PE=2 SV=2 275 1087 1.0E-83
sp|P98194|AT2C1_HUMAN Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens GN=ATP2C1 PE=1 SV=3 301 1185 1.0E-83
sp|O59868|ATC1_SCHPO Calcium-transporting ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmr1 PE=1 SV=1 280 1185 2.0E-83
sp|Q5R5K5|AT2C1_PONAB Calcium-transporting ATPase type 2C member 1 OS=Pongo abelii GN=ATP2C1 PE=2 SV=1 301 1185 4.0E-83
sp|P57709|AT2C1_BOVIN Calcium-transporting ATPase type 2C member 1 OS=Bos taurus GN=ATP2C1 PE=2 SV=1 301 1185 5.0E-83
sp|Q64578|AT2A1_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Rattus norvegicus GN=Atp2a1 PE=1 SV=1 287 1087 3.0E-81
sp|Q8R429|AT2A1_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Mus musculus GN=Atp2a1 PE=1 SV=1 287 1087 3.0E-81
sp|Q0VCY0|AT2A1_BOVIN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Bos taurus GN=ATP2A1 PE=1 SV=1 284 1087 1.0E-80
sp|Q64566|AT2C1_RAT Calcium-transporting ATPase type 2C member 1 OS=Rattus norvegicus GN=Atp2c1 PE=2 SV=1 344 1185 2.0E-80
sp|P04191|AT2A1_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Oryctolagus cuniculus GN=ATP2A1 PE=1 SV=1 284 1087 3.0E-80
sp|P54209|ATC1_DUNBI Cation-transporting ATPase CA1 OS=Dunaliella bioculata GN=CA1 PE=2 SV=1 284 1115 4.0E-80
sp|O14983|AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens GN=ATP2A1 PE=1 SV=1 287 1087 6.0E-80
sp|Q9SY55|ECA3_ARATH Calcium-transporting ATPase 3, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA3 PE=2 SV=3 272 1223 6.0E-80
sp|A7L9Z8|AT2C2_MOUSE Calcium-transporting ATPase type 2C member 2 OS=Mus musculus GN=Atp2c2 PE=2 SV=1 341 1185 5.0E-79
sp|Q03669|AT2A2_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Gallus gallus GN=ATP2A2 PE=2 SV=2 287 1100 7.0E-79
sp|P37367|ATA1_SYNY3 Cation-transporting ATPase pma1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pma1 PE=3 SV=2 275 1109 9.0E-79
sp|Q292Q0|ATC1_DROPS Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila pseudoobscura pseudoobscura GN=Ca-P60A PE=3 SV=2 287 1100 3.0E-78
sp|P22700|ATC1_DROME Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster GN=Ca-P60A PE=1 SV=2 287 1100 5.0E-78
sp|P35316|ATC_ARTSF Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Artemia franciscana PE=2 SV=1 287 1100 1.0E-77
sp|Q92105|AT2A1_PELES Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Pelophylax esculentus GN=ATP2A1 PE=2 SV=1 284 1087 2.0E-77
sp|P35315|ATC_TRYBB Probable calcium-transporting ATPase OS=Trypanosoma brucei brucei GN=TBA1 PE=3 SV=1 279 1116 2.0E-77
sp|Q80XR2|AT2C1_MOUSE Calcium-transporting ATPase type 2C member 1 OS=Mus musculus GN=Atp2c1 PE=1 SV=2 361 1185 2.0E-77
sp|P13585|AT2A1_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Gallus gallus GN=ATP2A1 PE=2 SV=2 284 1087 7.0E-77
sp|O55143|AT2A2_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Mus musculus GN=Atp2a2 PE=1 SV=2 287 1100 7.0E-77
sp|P11607|AT2A2_PIG Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Sus scrofa GN=ATP2A2 PE=1 SV=1 287 1100 7.0E-77
sp|P16615|AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 287 1100 7.0E-77
sp|O46674|AT2A2_CANLF Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Canis lupus familiaris GN=ATP2A2 PE=2 SV=1 287 1100 9.0E-77
sp|Q7PPA5|ATC1_ANOGA Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Anopheles gambiae GN=Ca-P60A PE=3 SV=5 287 1087 9.0E-77
sp|P11507|AT2A2_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Rattus norvegicus GN=Atp2a2 PE=1 SV=1 287 1100 1.0E-76
sp|P20647|AT2A2_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Oryctolagus cuniculus GN=ATP2A2 PE=2 SV=2 287 1100 1.0E-76
sp|Q00779|AT2A2_FELCA Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Felis catus GN=ATP2A2 PE=2 SV=1 287 1100 3.0E-76
sp|P24797|AT1A2_CHICK Sodium/potassium-transporting ATPase subunit alpha-2 OS=Gallus gallus GN=ATP1A2 PE=2 SV=1 302 1110 1.0E-75
sp|Q8R4C1|AT2C2_RAT Calcium-transporting ATPase type 2C member 2 OS=Rattus norvegicus GN=Atp2c2 PE=2 SV=1 341 1185 3.0E-75
sp|P47317|ATCL_MYCGE Probable cation-transporting P-type ATPase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pacL PE=3 SV=1 324 1074 2.0E-74
sp|P22189|ATC3_SCHPO Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 279 1124 7.0E-74
sp|P13607|ATNA_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster GN=Atpalpha PE=1 SV=3 349 1110 2.0E-73
sp|Q9WV27|AT1A4_MOUSE Sodium/potassium-transporting ATPase subunit alpha-4 OS=Mus musculus GN=Atp1a4 PE=1 SV=3 302 1110 2.0E-73
sp|P9WPS9|CTPF_MYCTU Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpF PE=1 SV=1 274 1174 3.0E-73
sp|P9WPS8|CTPF_MYCTO Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpF PE=2 SV=1 274 1174 3.0E-73
sp|P63688|CTPF_MYCBO Probable cation-transporting ATPase F OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpF PE=3 SV=1 274 1174 3.0E-73
sp|Q64541|AT1A4_RAT Sodium/potassium-transporting ATPase subunit alpha-4 OS=Rattus norvegicus GN=Atp1a4 PE=2 SV=1 302 1110 5.0E-73
sp|A2VDL6|AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus GN=ATP1A2 PE=2 SV=1 302 1110 6.0E-73
sp|P54707|AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens GN=ATP12A PE=1 SV=3 343 1081 8.0E-73
sp|Q9TV52|AT12A_RABIT Potassium-transporting ATPase alpha chain 2 OS=Oryctolagus cuniculus GN=ATP12A PE=2 SV=1 311 1112 1.0E-72
sp|P50993|AT1A2_HUMAN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens GN=ATP1A2 PE=1 SV=1 302 1110 1.0E-72
sp|D2WKD8|AT1A2_PIG Sodium/potassium-transporting ATPase subunit alpha-2 OS=Sus scrofa GN=ATP1A2 PE=1 SV=1 302 1110 1.0E-72
sp|Q9N0Z6|AT1A1_RABIT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oryctolagus cuniculus GN=ATP1A1 PE=1 SV=2 302 1110 2.0E-72
sp|O75185|AT2C2_HUMAN Calcium-transporting ATPase type 2C member 2 OS=Homo sapiens GN=ATP2C2 PE=1 SV=2 341 1186 3.0E-72
sp|P06686|AT1A2_RAT Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus GN=Atp1a2 PE=1 SV=1 302 1110 7.0E-72
sp|Q6PIE5|AT1A2_MOUSE Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus GN=Atp1a2 PE=1 SV=1 302 1110 7.0E-72
sp|Q92126|ATP4A_XENLA Potassium-transporting ATPase alpha chain 1 OS=Xenopus laevis GN=atp4a PE=2 SV=3 349 1078 7.0E-72
sp|Q5RCD8|AT1A2_PONAB Sodium/potassium-transporting ATPase subunit alpha-2 OS=Pongo abelii GN=ATP1A2 PE=2 SV=1 302 1110 1.0E-71
sp|Q64392|AT12A_CAVPO Potassium-transporting ATPase alpha chain 2 OS=Cavia porcellus GN=ATP12A PE=2 SV=1 311 1112 1.0E-71
sp|P13637|AT1A3_HUMAN Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens GN=ATP1A3 PE=1 SV=3 349 1110 3.0E-71
sp|P05024|AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa GN=ATP1A1 PE=1 SV=1 349 1110 4.0E-71
sp|P13587|ATN1_YEAST Sodium transport ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA1 PE=1 SV=1 266 1148 6.0E-71
sp|P24798|AT1A3_CHICK Sodium/potassium-transporting ATPase subunit alpha-3 OS=Gallus gallus GN=ATP1A3 PE=2 SV=1 302 1110 7.0E-71
sp|P06687|AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus GN=Atp1a3 PE=1 SV=2 349 1110 7.0E-71
sp|Q6PIC6|AT1A3_MOUSE Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus GN=Atp1a3 PE=1 SV=1 349 1110 7.0E-71
sp|P54708|AT12A_RAT Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus GN=Atp12a PE=1 SV=1 311 1112 7.0E-71
sp|P25489|AT1A1_CATCO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Catostomus commersonii GN=atp1a1 PE=2 SV=1 349 1110 1.0E-70
sp|P05025|AT1A_TORCA Sodium/potassium-transporting ATPase subunit alpha OS=Torpedo californica PE=1 SV=1 350 1110 1.0E-70
sp|P18907|AT1A1_HORSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Equus caballus GN=ATP1A1 PE=3 SV=1 349 1110 1.0E-70
sp|Q08DA1|AT1A1_BOVIN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Bos taurus GN=ATP1A1 PE=2 SV=1 302 1110 2.0E-70
sp|Q12691|ATN5_YEAST Sodium transport ATPase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA5 PE=1 SV=1 341 1148 2.0E-70
sp|P05023|AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1 349 1110 2.0E-70
sp|Q01896|ATN2_YEAST Sodium transport ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA2 PE=1 SV=1 341 1148 3.0E-70
sp|P06685|AT1A1_RAT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus GN=Atp1a1 PE=1 SV=1 349 1110 3.0E-70
sp|P04074|AT1A1_SHEEP Sodium/potassium-transporting ATPase subunit alpha-1 OS=Ovis aries GN=ATP1A1 PE=1 SV=1 302 1110 6.0E-70
sp|Q8VDN2|AT1A1_MOUSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus GN=Atp1a1 PE=1 SV=1 349 1110 2.0E-69
sp|Q5RDR3|AT1A1_PONAB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Pongo abelii GN=ATP1A1 PE=2 SV=1 349 1078 2.0E-69
sp|Q92036|AT12A_RHIMB Potassium-transporting ATPase alpha chain 2 OS=Rhinella marina GN=ATP12A PE=2 SV=1 312 1112 5.0E-69
sp|P09572|AT1A1_CHICK Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus GN=ATP1A1 PE=2 SV=1 349 1117 2.0E-68
sp|P50997|AT1A1_CANLF Sodium/potassium-transporting ATPase subunit alpha-1 OS=Canis lupus familiaris GN=ATP1A1 PE=2 SV=1 349 1110 2.0E-68
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 728 1161 2.0E-68
sp|P09626|ATP4A_RAT Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus GN=Atp4a PE=1 SV=3 352 1078 3.0E-68
sp|P35317|AT1A_HYDVU Sodium/potassium-transporting ATPase subunit alpha OS=Hydra vulgaris PE=2 SV=1 349 1078 5.0E-68
sp|P19156|ATP4A_PIG Potassium-transporting ATPase alpha chain 1 OS=Sus scrofa GN=ATP4A PE=1 SV=3 352 1078 6.0E-68
sp|Q6RWA9|AT1A_TAESO Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium PE=2 SV=1 349 1078 9.0E-68
sp|P20648|ATP4A_HUMAN Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens GN=ATP4A PE=2 SV=5 349 1078 9.0E-68
sp|P30714|AT1A1_RHIMB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rhinella marina GN=ATP1A1 PE=1 SV=2 349 1110 1.0E-67
sp|P27112|ATP4A_RABIT Potassium-transporting ATPase alpha chain 1 OS=Oryctolagus cuniculus GN=ATP4A PE=2 SV=3 352 1078 2.0E-67
sp|Q92123|AT1A1_XENLA Sodium/potassium-transporting ATPase subunit alpha-1 OS=Xenopus laevis GN=atp1a1 PE=2 SV=1 349 1110 2.0E-67
sp|Q92030|AT1A1_ANGAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Anguilla anguilla GN=atp1a1 PE=2 SV=1 302 1110 4.0E-67
sp|P58312|AT1A3_OREMO Sodium/potassium-transporting ATPase subunit alpha-3 OS=Oreochromis mossambicus GN=atp1a3 PE=2 SV=1 349 1078 1.0E-66
sp|Q9Z1W8|AT12A_MOUSE Potassium-transporting ATPase alpha chain 2 OS=Mus musculus GN=Atp12a PE=1 SV=3 347 1081 1.0E-66
sp|Q64436|ATP4A_MOUSE Potassium-transporting ATPase alpha chain 1 OS=Mus musculus GN=Atp4a PE=1 SV=3 380 1078 2.0E-66
sp|Q13733|AT1A4_HUMAN Sodium/potassium-transporting ATPase subunit alpha-4 OS=Homo sapiens GN=ATP1A4 PE=1 SV=3 384 1110 4.0E-66
sp|P50996|ATP4A_CANLF Potassium-transporting ATPase alpha chain 1 OS=Canis lupus familiaris GN=ATP4A PE=2 SV=3 352 1078 5.0E-66
sp|Q9YH26|AT1A1_OREMO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oreochromis mossambicus GN=atp1a1 PE=2 SV=2 349 1136 1.0E-65
sp|P28774|AT1B_ARTSF Sodium/potassium-transporting ATPase subunit alpha-B OS=Artemia franciscana PE=2 SV=1 350 1078 9.0E-64
sp|P17326|AT1A_ARTSF Sodium/potassium-transporting ATPase subunit alpha-A OS=Artemia franciscana PE=2 SV=1 350 1110 1.0E-63
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 389 1065 2.0E-44
sp|O53114|CTPI_MYCLE Probable cation-transporting ATPase I OS=Mycobacterium leprae (strain TN) GN=ctpI PE=3 SV=1 389 1065 6.0E-44
sp|Q9LY32|PMA7_ARATH ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=AHA7 PE=2 SV=1 279 1028 3.0E-38
sp|P28877|PMA1_CANAX Plasma membrane ATPase 1 OS=Candida albicans GN=PMA1 PE=1 SV=1 274 1123 2.0E-37
sp|P78036|ATCL_MYCPN Probable cation-transporting P-type ATPase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pacL PE=3 SV=1 701 1081 1.0E-35
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 280 488 1.0E-33
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 280 488 2.0E-33
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 280 488 2.0E-33
sp|P07038|PMA1_NEUCR Plasma membrane ATPase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pma-1 PE=1 SV=1 265 1024 3.0E-33
sp|P19657|PMA2_YEAST Plasma membrane ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA2 PE=1 SV=3 341 1024 4.0E-32
sp|P78036|ATCL_MYCPN Probable cation-transporting P-type ATPase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pacL PE=3 SV=1 287 625 2.0E-31
sp|P24545|PMA1_ZYGRO Plasma membrane ATPase OS=Zygosaccharomyces rouxii PE=3 SV=1 266 1123 3.0E-31
sp|P49380|PMA1_KLULA Plasma membrane ATPase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PMA1 PE=1 SV=1 341 1024 3.0E-30
sp|P0ABB8|ATMA_ECOLI Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli (strain K12) GN=mgtA PE=1 SV=1 286 1034 1.0E-28
sp|P0ABB9|ATMA_ECO57 Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli O157:H7 GN=mgtA PE=3 SV=1 286 1034 1.0E-28
sp|P28876|PMA2_SCHPO Plasma membrane ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma2 PE=3 SV=1 341 1067 3.0E-28
sp|Q07421|PMA1_AJECA Plasma membrane ATPase OS=Ajellomyces capsulatus GN=PMA1 PE=3 SV=1 255 1067 5.0E-28
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 267 615 3.0E-25
sp|Q58623|Y1226_METJA Putative cation-transporting ATPase MJ1226 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1226 PE=3 SV=1 280 651 5.0E-25
sp|Q12697|YPK9_YEAST Vacuolar cation-transporting ATPase YPK9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK9 PE=1 SV=1 341 1136 9.0E-25
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 601 980 2.0E-24
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 349 1137 6.0E-23
sp|P22036|ATMB_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtB PE=1 SV=3 741 1110 1.0E-22
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 346 901 2.0E-22
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 372 935 2.0E-22
sp|Q08435|PMA1_NICPL Plasma membrane ATPase 1 OS=Nicotiana plumbaginifolia GN=PMA1 PE=2 SV=1 730 1028 2.0E-22
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 372 935 3.0E-22
sp|P23980|PMA2_SOLLC Plasma membrane ATPase 2 (Fragment) OS=Solanum lycopersicum GN=LHA2 PE=3 SV=1 730 1028 3.0E-22
sp|O74431|ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.11c PE=3 SV=1 263 1107 2.0E-21
sp|P22180|PMA1_SOLLC Plasma membrane ATPase 1 OS=Solanum lycopersicum GN=LHA1 PE=2 SV=1 730 1028 2.0E-21
sp|P36640|ATMA_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtA PE=2 SV=1 741 1034 2.0E-21
sp|D0ZTB2|ATMA_SALT1 Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=mgtA PE=2 SV=1 741 1034 2.0E-21
sp|Q7XPY2|PMA1_ORYSJ Plasma membrane ATPase OS=Oryza sativa subsp. japonica GN=Os04g0656100 PE=2 SV=1 730 1035 3.0E-21
sp|P83970|PMA1_WHEAT Plasma membrane ATPase OS=Triticum aestivum GN=ha1 PE=2 SV=1 730 1028 4.0E-21
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 549 1111 4.0E-21
sp|Q08436|PMA3_NICPL Plasma membrane ATPase 3 OS=Nicotiana plumbaginifolia GN=PMA3 PE=1 SV=1 730 1028 4.0E-21
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 284 1116 4.0E-21
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 601 911 8.0E-21
sp|Q03194|PMA4_NICPL Plasma membrane ATPase 4 OS=Nicotiana plumbaginifolia GN=PMA4 PE=2 SV=1 766 1028 1.0E-20
sp|Q9M2A0|PMA8_ARATH ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=AHA8 PE=3 SV=1 725 1035 1.0E-20
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 346 1085 1.0E-20
sp|Q9SU58|PMA4_ARATH ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=AHA4 PE=2 SV=2 793 1028 1.0E-20
sp|Q9LV11|PMA11_ARATH ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=AHA11 PE=1 SV=1 730 1028 2.0E-20
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 601 1141 2.0E-20
sp|P19456|PMA2_ARATH ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=AHA2 PE=1 SV=2 782 1028 3.0E-20
sp|Q9SJB3|PMA5_ARATH ATPase 5, plasma membrane-type OS=Arabidopsis thaliana GN=AHA5 PE=3 SV=3 280 673 3.0E-20
sp|Q42556|PMA9_ARATH ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=AHA9 PE=2 SV=2 725 1028 5.0E-20
sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=actP PE=1 SV=1 810 1027 9.0E-20
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 559 987 1.0E-19
sp|P20649|PMA1_ARATH ATPase 1, plasma membrane-type OS=Arabidopsis thaliana GN=AHA1 PE=1 SV=3 800 1027 1.0E-19
sp|Q9SH76|PMA6_ARATH ATPase 6, plasma membrane-type OS=Arabidopsis thaliana GN=AHA6 PE=2 SV=1 725 1028 1.0E-19
sp|P20431|PMA3_ARATH ATPase 3, plasma membrane-type OS=Arabidopsis thaliana GN=AHA3 PE=1 SV=2 730 1028 1.0E-19
sp|Q43128|PMA10_ARATH ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=AHA10 PE=2 SV=2 730 1028 1.0E-19
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 397 1034 1.0E-19
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 284 1116 3.0E-19
sp|P58341|ATCU1_RHIME Copper-transporting ATPase 1 OS=Rhizobium meliloti (strain 1021) GN=actP1 PE=3 SV=1 774 1027 3.0E-19
sp|P73241|ATCS_SYNY3 Probable copper-transporting ATPase PacS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pacS PE=1 SV=1 812 1027 4.0E-19
sp|P19815|SPC1D_EMENI Conidium-specific protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=SpoC1-C1D PE=2 SV=2 112 262 4.0E-19
sp|Q9M2A0|PMA8_ARATH ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=AHA8 PE=3 SV=1 280 673 5.0E-19
sp|P19456|PMA2_ARATH ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=AHA2 PE=1 SV=2 279 673 5.0E-19
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 559 987 5.0E-19
sp|Q7XPY2|PMA1_ORYSJ Plasma membrane ATPase OS=Oryza sativa subsp. japonica GN=Os04g0656100 PE=2 SV=1 280 673 6.0E-19
sp|P9WPS3|CTPV_MYCTU Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpV PE=1 SV=1 845 1036 7.0E-19
sp|P9WPS2|CTPV_MYCTO Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpV PE=3 SV=1 845 1036 7.0E-19
sp|P32113|COPA_ENTHA Probable copper-importing P-type ATPase A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copA PE=1 SV=2 852 1027 8.0E-19
sp|O31688|ZOSA_BACSU Zinc-transporting ATPase OS=Bacillus subtilis (strain 168) GN=zosA PE=1 SV=1 847 1035 9.0E-19
sp|P83970|PMA1_WHEAT Plasma membrane ATPase OS=Triticum aestivum GN=ha1 PE=2 SV=1 266 673 1.0E-18
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 338 908 2.0E-18
sp|Q08436|PMA3_NICPL Plasma membrane ATPase 3 OS=Nicotiana plumbaginifolia GN=PMA3 PE=1 SV=1 383 673 3.0E-18
sp|P20649|PMA1_ARATH ATPase 1, plasma membrane-type OS=Arabidopsis thaliana GN=AHA1 PE=1 SV=3 279 673 3.0E-18
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 601 1078 3.0E-18
sp|C3LF99|KDPB_BACAC Potassium-transporting ATPase ATP-binding subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=kdpB PE=3 SV=1 848 1006 4.0E-18
sp|B7JRB8|KDPB_BACC0 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH820) GN=kdpB PE=3 SV=1 848 1006 4.0E-18
sp|Q6HN78|KDPB_BACHK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=kdpB PE=3 SV=1 848 1006 4.0E-18
sp|Q08435|PMA1_NICPL Plasma membrane ATPase 1 OS=Nicotiana plumbaginifolia GN=PMA1 PE=2 SV=1 279 673 5.0E-18
sp|P22180|PMA1_SOLLC Plasma membrane ATPase 1 OS=Solanum lycopersicum GN=LHA1 PE=2 SV=1 383 673 5.0E-18
sp|A9VFM1|KDPB_BACWK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=kdpB PE=3 SV=1 848 1006 5.0E-18
sp|A0RA13|KDPB_BACAH Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis (strain Al Hakam) GN=kdpB PE=3 SV=1 848 1006 5.0E-18
sp|B7II09|KDPB_BACC2 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain G9842) GN=kdpB PE=3 SV=1 848 1006 5.0E-18
sp|B7HWG1|KDPB_BACC7 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH187) GN=kdpB PE=3 SV=1 853 1006 5.0E-18
sp|C1EYK0|KDPB_BACC3 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain 03BB102) GN=kdpB PE=3 SV=1 848 1006 5.0E-18
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 603 987 6.0E-18
sp|Q81HQ0|KDPB_BACCR Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=kdpB PE=3 SV=1 853 1006 6.0E-18
sp|Q63FR0|KDPB_BACCZ Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ZK / E33L) GN=kdpB PE=3 SV=1 853 1006 6.0E-18
sp|Q42556|PMA9_ARATH ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=AHA9 PE=2 SV=2 383 624 7.0E-18
sp|Q8R8I6|KDPB_CALS4 Potassium-transporting ATPase ATP-binding subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=kdpB PE=3 SV=1 845 1006 7.0E-18
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 637 1145 7.0E-18
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 601 1111 9.0E-18
sp|Q03194|PMA4_NICPL Plasma membrane ATPase 4 OS=Nicotiana plumbaginifolia GN=PMA4 PE=2 SV=1 275 673 1.0E-17
sp|Q9SH76|PMA6_ARATH ATPase 6, plasma membrane-type OS=Arabidopsis thaliana GN=AHA6 PE=2 SV=1 279 673 1.0E-17
sp|Q4A0G1|COPA_STAS1 Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1 780 1027 1.0E-17
sp|P57699|KDPB_HALSA Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=kdpB PE=3 SV=1 848 1006 1.0E-17
sp|B0R9M0|KDPB_HALS3 Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=kdpB PE=2 SV=1 848 1006 1.0E-17
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 601 1123 1.0E-17
sp|Q9X8Z9|KDPB_STRCO Potassium-transporting ATPase ATP-binding subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=kdpB PE=3 SV=3 847 1006 1.0E-17
sp|P54679|PMA1_DICDI Probable plasma membrane ATPase OS=Dictyostelium discoideum GN=patB PE=2 SV=2 287 624 1.0E-17
sp|B7HDF9|KDPB_BACC4 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain B4264) GN=kdpB PE=3 SV=1 848 1006 2.0E-17
sp|Q9RZP0|KDPB_DEIRA Potassium-transporting ATPase ATP-binding subunit OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=kdpB PE=3 SV=1 851 1008 2.0E-17
sp|Q2YWA3|COPA_STAAB Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=copA PE=3 SV=1 848 1027 2.0E-17
sp|B4U8E4|KDPB_HYDS0 Potassium-transporting ATPase ATP-binding subunit OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=kdpB PE=3 SV=1 847 1049 2.0E-17
sp|Q7A3E6|COPA_STAAN Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 848 1027 3.0E-17
sp|Q99R80|COPA_STAAM Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 848 1027 3.0E-17
sp|A5IVY3|COPA_STAA9 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 848 1027 3.0E-17
sp|A6U4T8|COPA_STAA2 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 848 1027 3.0E-17
sp|A7X6S1|COPA_STAA1 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=copA PE=3 SV=1 848 1027 3.0E-17
sp|Q6GDP1|COPA_STAAR Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MRSA252) GN=copA PE=3 SV=1 848 1027 3.0E-17
sp|Q8NUQ9|COPA_STAAW Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MW2) GN=copA PE=3 SV=1 848 1027 3.0E-17
sp|Q6G6B7|COPA_STAAS Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MSSA476) GN=copA PE=3 SV=1 848 1027 3.0E-17
sp|Q9X5V3|ATCU_RHILV Copper-transporting P-type ATPase OS=Rhizobium leguminosarum bv. viciae GN=actP PE=1 SV=1 832 1027 3.0E-17
sp|A6QK47|COPA_STAAE Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Newman) GN=copA PE=3 SV=1 848 1027 3.0E-17
sp|Q5HCZ3|COPA_STAAC Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain COL) GN=copA PE=3 SV=1 848 1027 3.0E-17
sp|Q2FV64|COPA_STAA8 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain NCTC 8325) GN=copA PE=1 SV=1 848 1027 3.0E-17
sp|A8Z3F8|COPA_STAAT Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copA PE=3 SV=1 848 1027 3.0E-17
sp|Q2FDV0|COPA_STAA3 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300) GN=copA PE=3 SV=1 848 1027 3.0E-17
sp|P37279|ATCS_SYNE7 Probable copper-transporting ATPase PacS OS=Synechococcus elongatus (strain PCC 7942) GN=pacS PE=3 SV=2 848 1027 3.0E-17
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 298 1007 3.0E-17
sp|Q9SU58|PMA4_ARATH ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=AHA4 PE=2 SV=2 383 673 3.0E-17
sp|O14022|CTA5_SCHPO Cation-transporting ATPase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta5 PE=3 SV=1 397 1114 3.0E-17
sp|P54211|PMA1_DUNBI Plasma membrane ATPase OS=Dunaliella bioculata GN=PMA1 PE=2 SV=1 731 1031 3.0E-17
sp|Q8NVI2|KDPB_STAAW Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MW2) GN=kdpB PE=3 SV=1 851 1006 4.0E-17
sp|Q6G7N3|KDPB_STAAS Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MSSA476) GN=kdpB PE=3 SV=1 851 1006 4.0E-17
sp|P63684|KDPB2_STAAN Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain N315) GN=kdpB2 PE=3 SV=1 851 1006 4.0E-17
sp|P63683|KDPB2_STAAM Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB2 PE=3 SV=1 851 1006 4.0E-17
sp|A8Z4X9|KDPB_STAAT Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=kdpB PE=3 SV=1 851 1006 4.0E-17
sp|A6QIS1|KDPB_STAAE Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain Newman) GN=kdpB PE=3 SV=1 851 1006 4.0E-17
sp|Q5HEC4|KDPB_STAAC Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain COL) GN=kdpB PE=3 SV=1 851 1006 4.0E-17
sp|Q8XD24|COPA_ECO57 Copper-exporting P-type ATPase A OS=Escherichia coli O157:H7 GN=copA PE=3 SV=3 848 1029 4.0E-17
sp|P54210|PMA1_DUNAC Plasma membrane ATPase OS=Dunaliella acidophila GN=DHA1 PE=2 SV=1 739 1102 4.0E-17
sp|Q6GEZ7|KDPB2_STAAR Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB2 PE=3 SV=1 851 1006 4.0E-17
sp|Q2YUH7|KDPB_STAAB Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=kdpB PE=3 SV=1 851 1006 4.0E-17
sp|Q9ZHC7|SILP_SALTM Silver exporting P-type ATPase OS=Salmonella typhimurium GN=silP PE=1 SV=1 848 1027 5.0E-17
sp|Q93MV5|KDPB_MYXXA Potassium-transporting ATPase ATP-binding subunit OS=Myxococcus xanthus GN=kdpB PE=3 SV=1 829 1006 5.0E-17
sp|Q9LV11|PMA11_ARATH ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=AHA11 PE=1 SV=1 383 673 6.0E-17
sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti (strain 1021) GN=actP2 PE=3 SV=1 810 1027 8.0E-17
sp|A7GLG4|KDPB_BACCN Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=kdpB PE=3 SV=1 853 1006 8.0E-17
sp|Q9SJB3|PMA5_ARATH ATPase 5, plasma membrane-type OS=Arabidopsis thaliana GN=AHA5 PE=3 SV=3 730 1028 8.0E-17
sp|Q57RN0|KDPB_SALCH Potassium-transporting ATPase ATP-binding subunit OS=Salmonella choleraesuis (strain SC-B67) GN=kdpB PE=3 SV=1 852 1006 9.0E-17
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 601 1108 1.0E-16
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 389 627 1.0E-16
sp|Q5HK64|KDPB_STAEQ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=kdpB PE=3 SV=1 845 1006 1.0E-16
sp|Q6GKN3|KDPB1_STAAR Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB1 PE=3 SV=1 845 1006 1.0E-16
sp|P0A008|KDPB1_STAAN Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain N315) GN=kdpB1 PE=3 SV=1 845 1006 1.0E-16
sp|P0A007|KDPB1_STAAM Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB1 PE=3 SV=1 845 1006 1.0E-16
sp|Q59385|COPA_ECOLI Copper-exporting P-type ATPase A OS=Escherichia coli (strain K12) GN=copA PE=1 SV=4 848 1016 1.0E-16
sp|Q4LAI2|KDPB_STAHJ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=kdpB PE=3 SV=1 845 1006 1.0E-16
sp|Q9SH30|HMA5_ARATH Probable copper-transporting ATPase HMA5 OS=Arabidopsis thaliana GN=HMA5 PE=1 SV=2 851 1027 1.0E-16
sp|Q8CN02|COPA_STAES Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1 853 1027 2.0E-16
sp|Q5HL56|COPA_STAEQ Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1 853 1027 2.0E-16
sp|P11718|ATXA_LEIDO Probable proton ATPase 1A OS=Leishmania donovani GN=H1A PE=2 SV=2 730 1036 2.0E-16
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 724 1126 3.0E-16
sp|P12522|ATXB_LEIDO Probable proton ATPase 1B OS=Leishmania donovani GN=H1B PE=2 SV=1 730 1036 3.0E-16
sp|P9WPU3|KDPB_MYCTU Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdpB PE=3 SV=1 852 1006 3.0E-16
sp|P9WPU2|KDPB_MYCTO Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdpB PE=3 SV=1 852 1006 3.0E-16
sp|P63682|KDPB_MYCBO Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kdpB PE=3 SV=1 852 1006 3.0E-16
sp|Q8Z8S4|COPA_SALTI Copper-exporting P-type ATPase A OS=Salmonella typhi GN=copA PE=3 SV=3 854 1016 3.0E-16
sp|Q8ZR95|COPA_SALTY Copper-exporting P-type ATPase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=copA PE=1 SV=3 854 1016 3.0E-16
sp|O32220|COPA_BACSU Copper-exporting P-type ATPase A OS=Bacillus subtilis (strain 168) GN=copA PE=1 SV=2 853 1023 4.0E-16
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 601 1064 4.0E-16
sp|P20431|PMA3_ARATH ATPase 3, plasma membrane-type OS=Arabidopsis thaliana GN=AHA3 PE=1 SV=2 279 673 4.0E-16
sp|Q9S7J8|HMA7_ARATH Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 851 1027 5.0E-16
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 601 926 5.0E-16
sp|P09627|PMA1_SCHPO Plasma membrane ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma1 PE=1 SV=1 341 624 8.0E-16
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 601 900 8.0E-16
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 601 980 9.0E-16
sp|P73867|KDPB_SYNY3 Potassium-transporting ATPase ATP-binding subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=kdpB PE=3 SV=1 845 1064 9.0E-16
sp|O32328|KDPB_CLOAB Potassium-transporting ATPase ATP-binding subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=kdpB PE=3 SV=2 848 1006 1.0E-15
sp|Q8ZCA7|COPA_YERPE Copper-exporting P-type ATPase A OS=Yersinia pestis GN=copA PE=3 SV=1 782 1016 1.0E-15
sp|P36640|ATMA_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtA PE=2 SV=1 286 622 1.0E-15
sp|D0ZTB2|ATMA_SALT1 Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=mgtA PE=2 SV=1 286 622 1.0E-15
sp|Q9R6X1|KDPB_ANASL Potassium-transporting ATPase ATP-binding subunit OS=Anabaena sp. (strain L31) GN=kdpB PE=3 SV=1 848 1006 2.0E-15
sp|P05030|PMA1_YEAST Plasma membrane ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA1 PE=1 SV=2 256 624 2.0E-15
sp|P05030|PMA1_YEAST Plasma membrane ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA1 PE=1 SV=2 738 1024 3.0E-15
sp|P35597|EXP7_STRPN Probable cation-transporting ATPase exp7 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp7 PE=3 SV=2 848 1044 3.0E-15
sp|Q8YSD5|KDPB2_NOSS1 Potassium-transporting ATPase ATP-binding subunit 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB2 PE=3 SV=1 845 1006 3.0E-15
sp|Q8YPE9|KDPB1_NOSS1 Potassium-transporting ATPase ATP-binding subunit 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB1 PE=3 SV=1 848 1006 3.0E-15
sp|P12522|ATXB_LEIDO Probable proton ATPase 1B OS=Leishmania donovani GN=H1B PE=2 SV=1 287 624 4.0E-15
sp|Q9KPZ7|COPA_VIBCH Copper-exporting P-type ATPase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=copA PE=3 SV=1 846 1016 5.0E-15
sp|P54679|PMA1_DICDI Probable plasma membrane ATPase OS=Dictyostelium discoideum GN=patB PE=2 SV=2 742 1024 5.0E-15
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 557 900 8.0E-15
sp|P9WPT5|CTPC_MYCTU Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpC PE=1 SV=1 848 1029 8.0E-15
sp|P9WPT4|CTPC_MYCTO Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpC PE=3 SV=1 848 1029 8.0E-15
sp|P0A503|CTPC_MYCBO Probable cation-transporting P-type ATPase C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpC PE=3 SV=1 848 1029 8.0E-15
sp|Q4L970|COPA_STAHJ Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 845 1027 9.0E-15
sp|P11718|ATXA_LEIDO Probable proton ATPase 1A OS=Leishmania donovani GN=H1A PE=2 SV=2 287 624 1.0E-14
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 601 900 1.0E-14
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 603 1176 1.0E-14
sp|Q8XU11|KDPB_RALSO Potassium-transporting ATPase ATP-binding subunit OS=Ralstonia solanacearum (strain GMI1000) GN=kdpB PE=3 SV=1 852 1006 1.0E-14
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 601 926 1.0E-14
sp|Q92XJ0|KDPB_RHIME Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium meliloti (strain 1021) GN=kdpB PE=3 SV=1 851 1006 1.0E-14
sp|Q27533|YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans GN=W08D2.5 PE=3 SV=2 341 903 1.0E-14
sp|A4SZG8|KDPB_POLSQ Potassium-transporting ATPase ATP-binding subunit OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=kdpB PE=3 SV=1 852 1006 1.0E-14
sp|Q9SZW4|HMA2_ARATH Cadmium/zinc-transporting ATPase HMA2 OS=Arabidopsis thaliana GN=HMA2 PE=2 SV=1 845 1031 2.0E-14
sp|Q9T0E0|PMAX_ARATH Putative ATPase, plasma membrane-like OS=Arabidopsis thaliana GN=At4g11730 PE=3 SV=1 279 673 2.0E-14
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 342 902 2.0E-14
sp|Q6GIX1|CADA_STAAR Probable cadmium-transporting ATPase OS=Staphylococcus aureus (strain MRSA252) GN=cadA PE=3 SV=1 848 1067 3.0E-14
sp|Q60048|CADA_LISMN Probable cadmium-transporting ATPase OS=Listeria monocytogenes GN=cadA PE=1 SV=1 848 1062 3.0E-14
sp|Q9CCL1|CTPC_MYCLE Probable cation-transporting P-type ATPase C OS=Mycobacterium leprae (strain TN) GN=ctpC PE=3 SV=1 848 1029 3.0E-14
sp|Q8KU73|KDPB_ENTFA Potassium-transporting ATPase ATP-binding subunit OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=kdpB PE=3 SV=1 845 1006 3.0E-14
sp|Q64430|ATP7A_MOUSE Copper-transporting ATPase 1 OS=Mus musculus GN=Atp7a PE=1 SV=3 848 1027 4.0E-14
sp|P35670|ATP7B_HUMAN Copper-transporting ATPase 2 OS=Homo sapiens GN=ATP7B PE=1 SV=4 848 1027 4.0E-14
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 738 989 4.0E-14
sp|Q98GX6|KDPB_RHILO Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium loti (strain MAFF303099) GN=kdpB PE=3 SV=1 732 1008 5.0E-14
sp|A6T6D8|KDPB_KLEP7 Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=kdpB PE=3 SV=1 852 1006 5.0E-14
sp|Q8Z8E5|KDPB_SALTI Putative potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhi GN=kdpB PE=5 SV=1 852 1006 6.0E-14
sp|Q926K7|KDPB2_LISIN Potassium-transporting ATPase ATP-binding subunit 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB2 PE=3 SV=1 853 1006 6.0E-14
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 601 908 6.0E-14
sp|Q9A7X7|KDPB_CAUCR Potassium-transporting ATPase ATP-binding subunit OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=kdpB PE=3 SV=1 845 1006 6.0E-14
sp|P37386|CADA2_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 848 1067 6.0E-14
sp|B5XZE9|KDPB_KLEP3 Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae (strain 342) GN=kdpB PE=3 SV=1 852 1006 6.0E-14
sp|B1JR96|KDPB_YERPY Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=kdpB PE=3 SV=1 852 1006 6.0E-14
sp|A7FFQ9|KDPB_YERP3 Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=kdpB PE=3 SV=1 852 1006 6.0E-14
sp|Q43128|PMA10_ARATH ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=AHA10 PE=2 SV=2 279 673 6.0E-14
sp|P9WPT0|CTPE_MYCTO Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpE PE=3 SV=1 852 1035 7.0E-14
sp|Q667S4|KDPB_YERPS Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=kdpB PE=3 SV=1 852 1006 7.0E-14
sp|A4TL06|KDPB_YERPP Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis (strain Pestoides F) GN=kdpB PE=3 SV=1 852 1006 7.0E-14
sp|Q1CKH2|KDPB_YERPN Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=kdpB PE=3 SV=1 852 1006 7.0E-14
sp|A9R3X3|KDPB_YERPG Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Angola) GN=kdpB PE=3 SV=1 852 1006 7.0E-14
sp|Q8ZD97|KDPB_YERPE Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis GN=kdpB PE=3 SV=1 852 1006 7.0E-14
sp|B2KA78|KDPB_YERPB Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=kdpB PE=3 SV=1 852 1006 7.0E-14
sp|Q1C586|KDPB_YERPA Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=kdpB PE=3 SV=1 852 1006 7.0E-14
sp|A1JQS2|KDPB_YERE8 Potassium-transporting ATPase ATP-binding subunit OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=kdpB PE=3 SV=1 852 1006 7.0E-14
sp|Q04656|ATP7A_HUMAN Copper-transporting ATPase 1 OS=Homo sapiens GN=ATP7A PE=1 SV=3 848 1027 7.0E-14
sp|P9WPT1|CTPE_MYCTU Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpE PE=1 SV=1 852 1035 7.0E-14
sp|P0A505|CTPE_MYCBO Probable cation-transporting ATPase E OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpE PE=3 SV=1 852 1035 7.0E-14
sp|P70705|ATP7A_RAT Copper-transporting ATPase 1 OS=Rattus norvegicus GN=Atp7a PE=1 SV=1 848 1027 7.0E-14
sp|Q58623|Y1226_METJA Putative cation-transporting ATPase MJ1226 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1226 PE=3 SV=1 851 1032 7.0E-14
sp|Q7N6W6|KDPB_PHOLL Potassium-transporting ATPase ATP-binding subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=kdpB PE=3 SV=1 852 1006 8.0E-14
sp|B4SZB1|KDPB_SALNS Potassium-transporting ATPase ATP-binding subunit OS=Salmonella newport (strain SL254) GN=kdpB PE=3 SV=1 851 1006 9.0E-14
sp|Q8ZQW2|KDPB_SALTY Potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=kdpB PE=3 SV=1 852 1006 9.0E-14
sp|B5BCA4|KDPB_SALPK Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain AKU_12601) GN=kdpB PE=3 SV=1 852 1006 9.0E-14
sp|Q5PCJ7|KDPB_SALPA Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=kdpB PE=3 SV=1 852 1006 9.0E-14
sp|B4TQ22|KDPB_SALSV Potassium-transporting ATPase ATP-binding subunit OS=Salmonella schwarzengrund (strain CVM19633) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|B4TBA6|KDPB_SALHS Potassium-transporting ATPase ATP-binding subunit OS=Salmonella heidelberg (strain SL476) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|B5QWE9|KDPB_SALEP Potassium-transporting ATPase ATP-binding subunit OS=Salmonella enteritidis PT4 (strain P125109) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|A9MUE0|KDPB_SALPB Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|B5FNE0|KDPB_SALDC Potassium-transporting ATPase ATP-binding subunit OS=Salmonella dublin (strain CT_02021853) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|B5R670|KDPB_SALG2 Potassium-transporting ATPase ATP-binding subunit OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|Q1REM0|KDPB_ECOUT Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain UTI89 / UPEC) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|A1A8W1|KDPB_ECOK1 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O1:K1 / APEC GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|B7MFW2|KDPB_ECO45 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|Q3Z4A6|KDPB_SHISS Potassium-transporting ATPase ATP-binding subunit OS=Shigella sonnei (strain Ss046) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|B6HYQ5|KDPB_ECOSE Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SE11) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|A7ZJ80|KDPB_ECO24 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|B1LLE1|KDPB_ECOSM Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|Q8FJV4|KDPB_ECOL6 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|Q0TJY9|KDPB_ECOL5 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|A7ZXV8|KDPB_ECOHS Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O9:H4 (strain HS) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|B7UKX6|KDPB_ECO27 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|B7MPK0|KDPB_ECO81 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O81 (strain ED1a) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|B7NMQ0|KDPB_ECO7I Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|B7N9U0|KDPB_ECOLU Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|P03960|KDPB_ECOLI Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12) GN=kdpB PE=1 SV=3 852 1006 1.0E-13
sp|B1X6M8|KDPB_ECODH Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / DH10B) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|C4ZWH3|KDPB_ECOBW Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|B5YQN9|KDPB_ECO5E Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|Q8X9F9|KDPB_ECO57 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|B1IY32|KDPB_ECOLC Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=kdpB PE=3 SV=1 852 1006 1.0E-13
sp|P20021|CADA1_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 850 1067 1.0E-13
sp|Q9XT50|ATP7B_SHEEP Copper-transporting ATPase 2 OS=Ovis aries GN=ATP7B PE=2 SV=1 848 1027 1.0E-13
sp|O29777|COPA_ARCFU Probable copper-exporting P-type ATPase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copA PE=1 SV=1 853 1027 2.0E-13
sp|A4W860|KDPB_ENT38 Potassium-transporting ATPase ATP-binding subunit OS=Enterobacter sp. (strain 638) GN=kdpB PE=3 SV=1 850 1006 2.0E-13
sp|B5EZE3|KDPB_SALA4 Potassium-transporting ATPase ATP-binding subunit OS=Salmonella agona (strain SL483) GN=kdpB PE=3 SV=1 852 1006 2.0E-13
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 398 1112 2.0E-13
sp|Q324L0|KDPB_SHIBS Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=kdpB PE=3 SV=1 852 1006 2.0E-13
sp|C4LDL7|KDPB_TOLAT Potassium-transporting ATPase ATP-binding subunit OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=kdpB PE=3 SV=1 852 1006 2.0E-13
sp|Q0TRT3|KDPB_CLOP1 Potassium-transporting ATPase ATP-binding subunit OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=kdpB PE=3 SV=1 847 1006 2.0E-13
sp|P57700|KDPB_THEAC Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=kdpB PE=3 SV=1 851 1008 2.0E-13
sp|Q97BF6|KDPB_THEVO Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=kdpB PE=3 SV=1 851 1008 2.0E-13
sp|B7LKR7|KDPB_ESCF3 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=kdpB PE=3 SV=1 852 1006 3.0E-13
sp|B7M5L3|KDPB_ECO8A Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O8 (strain IAI1) GN=kdpB PE=3 SV=1 852 1006 3.0E-13
sp|B7LAA4|KDPB_ECO55 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain 55989 / EAEC) GN=kdpB PE=3 SV=1 852 1006 3.0E-13
sp|Q64446|ATP7B_MOUSE Copper-transporting ATPase 2 OS=Mus musculus GN=Atp7b PE=1 SV=2 848 1027 3.0E-13
sp|P49015|ATP7A_CRIGR Copper-transporting ATPase 1 (Fragment) OS=Cricetulus griseus GN=ATP7A PE=2 SV=1 848 1027 4.0E-13
sp|P9WPU1|CTPA_MYCTU Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpA PE=1 SV=1 853 1027 4.0E-13
sp|P9WPU0|CTPA_MYCTO Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpA PE=3 SV=1 853 1027 4.0E-13
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 738 936 6.0E-13
sp|P54210|PMA1_DUNAC Plasma membrane ATPase OS=Dunaliella acidophila GN=DHA1 PE=2 SV=1 385 624 7.0E-13
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 601 980 7.0E-13
sp|B2TMJ2|KDPB_CLOBB Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=kdpB PE=3 SV=1 847 1006 8.0E-13
sp|A8GB61|KDPB_SERP5 Potassium-transporting ATPase ATP-binding subunit OS=Serratia proteamaculans (strain 568) GN=kdpB PE=3 SV=1 852 1006 9.0E-13
sp|B2V2P3|KDPB_CLOBA Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=kdpB PE=3 SV=1 847 1006 9.0E-13
sp|O29777|COPA_ARCFU Probable copper-exporting P-type ATPase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copA PE=1 SV=1 378 624 1.0E-12
sp|Q64535|ATP7B_RAT Copper-transporting ATPase 2 OS=Rattus norvegicus GN=Atp7b PE=1 SV=1 848 1027 1.0E-12
sp|Q8U9D9|KDPB_AGRFC Potassium-transporting ATPase ATP-binding subunit OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=kdpB PE=3 SV=2 845 1006 1.0E-12
sp|B2VJK3|KDPB_ERWT9 Potassium-transporting ATPase ATP-binding subunit OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=kdpB PE=3 SV=1 852 1006 1.0E-12
sp|Q47H39|KDPB_DECAR Potassium-transporting ATPase ATP-binding subunit OS=Dechloromonas aromatica (strain RCB) GN=kdpB PE=3 SV=1 852 1006 1.0E-12
sp|Q69HU0|COPB_STAAU Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus GN=copB PE=3 SV=1 810 1027 1.0E-12
sp|P54211|PMA1_DUNBI Plasma membrane ATPase OS=Dunaliella bioculata GN=PMA1 PE=2 SV=1 342 624 2.0E-12
sp|Q6GIX4|COPB_STAAR Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain MRSA252) GN=copB PE=3 SV=1 810 1027 2.0E-12
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 601 908 2.0E-12
sp|P38995|ATU2_YEAST Copper-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCC2 PE=1 SV=1 853 1065 2.0E-12
sp|P37385|ATSY_SYNE7 Probable copper-transporting ATPase SynA OS=Synechococcus elongatus (strain PCC 7942) GN=synA PE=3 SV=1 833 1029 2.0E-12
sp|P07893|ATSY_SYNP6 Probable copper-transporting ATPase SynA OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=synA PE=3 SV=2 833 1025 2.0E-12
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 724 903 2.0E-12
sp|Q5HKB0|COPB_STAEQ Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copB PE=3 SV=2 810 1037 2.0E-12
sp|Q8CQF7|COPB_STAES Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copB PE=3 SV=1 838 1017 3.0E-12
sp|P58414|CADA_LISMO Probable cadmium-transporting ATPase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cadA PE=3 SV=1 850 1022 3.0E-12
sp|A8YZ02|COPB_STAAT Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copB PE=3 SV=1 838 1052 3.0E-12
sp|Q2FKI2|COPB_STAA3 Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300) GN=copB PE=3 SV=1 838 1052 3.0E-12
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 373 911 3.0E-12
sp|P30336|CADA_BACPE Probable cadmium-transporting ATPase OS=Bacillus pseudofirmus (strain OF4) GN=cadA PE=3 SV=2 851 1067 3.0E-12
sp|P09627|PMA1_SCHPO Plasma membrane ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma1 PE=1 SV=1 737 1067 4.0E-12
sp|B2TTJ7|KDPB_SHIB3 Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=kdpB PE=3 SV=1 852 1006 4.0E-12
sp|A0AM16|KDPB_LISW6 Potassium-transporting ATPase ATP-binding subunit OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=kdpB PE=3 SV=1 845 1006 4.0E-12
sp|Q8Y3Z7|KDPB_LISMO Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=kdpB PE=3 SV=1 845 1006 5.0E-12
sp|B8DAW1|KDPB_LISMH Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=kdpB PE=3 SV=1 845 1006 5.0E-12
sp|Q71W90|KDPB_LISMF Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=kdpB PE=3 SV=1 845 1006 5.0E-12
sp|C1KZN5|KDPB_LISMC Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=kdpB PE=3 SV=1 845 1006 5.0E-12
sp|Q927G0|KDPB1_LISIN Potassium-transporting ATPase ATP-binding subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB1 PE=3 SV=1 845 1006 5.0E-12
sp|Q4LAB1|COPB_STAHJ Probable copper-transporting P-type ATPase B OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copB PE=3 SV=2 810 1017 8.0E-12
sp|P46840|CTPB_MYCLE Cation-transporting P-type ATPase B OS=Mycobacterium leprae (strain TN) GN=ctpB PE=3 SV=2 828 1027 9.0E-12
sp|P77868|Y290_HAEIN Probable cation-transporting ATPase HI_0290 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0290 PE=3 SV=1 842 1027 9.0E-12
sp|P37279|ATCS_SYNE7 Probable copper-transporting ATPase PacS OS=Synechococcus elongatus (strain PCC 7942) GN=pacS PE=3 SV=2 277 621 1.0E-11
sp|P9WPT0|CTPE_MYCTO Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpE PE=3 SV=1 357 624 1.0E-11
sp|P9WPT1|CTPE_MYCTU Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpE PE=1 SV=1 357 624 1.0E-11
sp|P0A505|CTPE_MYCBO Probable cation-transporting ATPase E OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpE PE=3 SV=1 357 624 1.0E-11
sp|O64474|HMA4_ARATH Putative cadmium/zinc-transporting ATPase HMA4 OS=Arabidopsis thaliana GN=HMA4 PE=1 SV=2 853 1031 1.0E-11
sp|P0CW78|HMA3B_ARATH Cadmium/zinc-transporting ATPase HMA3 OS=Arabidopsis thaliana GN=HMA3 PE=1 SV=1 845 1032 1.0E-11
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 551 1111 1.0E-11
sp|B9DFX7|HMA8_ARATH Copper-transporting ATPase PAA2, chloroplastic OS=Arabidopsis thaliana GN=PAA2 PE=2 SV=1 851 1027 1.0E-11
sp|Q72TM6|KDPB_LEPIC Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=kdpB PE=3 SV=1 851 1006 2.0E-11
sp|P59219|KDPB_LEPIN Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=kdpB PE=3 SV=2 851 1006 2.0E-11
sp|O32619|COPA_HELFC Copper-transporting ATPase OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=copA PE=3 SV=1 848 1027 2.0E-11
sp|P35597|EXP7_STRPN Probable cation-transporting ATPase exp7 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp7 PE=3 SV=2 359 658 2.0E-11
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 601 924 3.0E-11
sp|Q59467|COPA2_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 851 1023 8.0E-11
sp|A8YZ02|COPB_STAAT Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copB PE=3 SV=1 382 624 8.0E-11
sp|Q2FKI2|COPB_STAA3 Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300) GN=copB PE=3 SV=1 382 624 8.0E-11
sp|P55989|COPA_HELPY Copper-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=copA PE=3 SV=1 851 1023 1.0E-10
sp|O30085|COPB_ARCFU Copper-exporting P-type ATPase B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copB PE=1 SV=1 384 633 1.0E-10
sp|P9WPT9|CTPB_MYCTU Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpB PE=1 SV=1 857 1027 1.0E-10
sp|P9WPT8|CTPB_MYCTO Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpB PE=3 SV=1 857 1027 1.0E-10
sp|P59947|CTPB_MYCBO Cation-transporting P-type ATPase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpB PE=3 SV=1 857 1027 1.0E-10
sp|Q5HKB0|COPB_STAEQ Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copB PE=3 SV=2 382 624 1.0E-10
sp|Q8CQF7|COPB_STAES Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copB PE=3 SV=1 382 624 1.0E-10
sp|Q4LAB1|COPB_STAHJ Probable copper-transporting P-type ATPase B OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copB PE=3 SV=2 382 624 1.0E-10
sp|O59666|ATU2_SCHPO Copper-transporting ATPase ccc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccc2 PE=3 SV=1 848 1032 2.0E-10
sp|Q8PCM1|KDPB_XANCP Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=kdpB PE=3 SV=1 852 1006 2.0E-10
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 507 901 2.0E-10
sp|Q8PPC9|KDPB_XANAC Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas axonopodis pv. citri (strain 306) GN=kdpB PE=3 SV=1 852 1006 2.0E-10
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 601 1141 2.0E-10
sp|P32113|COPA_ENTHA Probable copper-importing P-type ATPase A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copA PE=1 SV=2 311 624 2.0E-10
sp|P77871|COPA1_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=2 851 1023 5.0E-10
sp|O32219|CADA_BACSU Cadmium, zinc and cobalt-transporting ATPase OS=Bacillus subtilis (strain 168) GN=cadA PE=1 SV=1 848 1029 5.0E-10
sp|P58341|ATCU1_RHIME Copper-transporting ATPase 1 OS=Rhizobium meliloti (strain 1021) GN=actP1 PE=3 SV=1 300 621 5.0E-10
sp|Q9ZM69|COPA_HELPJ Copper-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=copA PE=3 SV=1 851 1023 6.0E-10
sp|Q9ZL53|HMCT_HELPJ Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=cadA PE=3 SV=1 848 1029 6.0E-10
sp|P05425|COPB_ENTHA Copper-exporting P-type ATPase B OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copB PE=1 SV=2 393 629 6.0E-10
sp|Q69HU0|COPB_STAAU Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus GN=copB PE=3 SV=1 382 624 6.0E-10
sp|Q6GIX4|COPB_STAAR Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain MRSA252) GN=copB PE=3 SV=1 382 624 7.0E-10
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 607 900 8.0E-10
sp|P57698|KDPB_PSEAE Potassium-transporting ATPase ATP-binding subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=kdpB PE=3 SV=1 851 1006 8.0E-10
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 557 901 9.0E-10
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 601 908 1.0E-09
sp|O08462|COPA3_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 851 1023 1.0E-09
sp|P37617|ATZN_ECOLI Lead, cadmium, zinc and mercury-transporting ATPase OS=Escherichia coli (strain K12) GN=zntA PE=1 SV=1 845 1058 1.0E-09
sp|O30085|COPB_ARCFU Copper-exporting P-type ATPase B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copB PE=1 SV=1 845 1038 2.0E-09
sp|P46839|CTPA_MYCLE Cation-transporting P-type ATPase A OS=Mycobacterium leprae (strain TN) GN=ctpA PE=3 SV=2 881 995 2.0E-09
sp|P77868|Y290_HAEIN Probable cation-transporting ATPase HI_0290 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0290 PE=3 SV=1 320 680 2.0E-09
sp|Q7A3E6|COPA_STAAN Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 378 621 3.0E-09
sp|Q99R80|COPA_STAAM Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 378 621 3.0E-09
sp|A5IVY3|COPA_STAA9 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 378 621 3.0E-09
sp|A6U4T8|COPA_STAA2 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 378 621 3.0E-09
sp|A7X6S1|COPA_STAA1 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=copA PE=3 SV=1 378 621 3.0E-09
sp|P05425|COPB_ENTHA Copper-exporting P-type ATPase B OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copB PE=1 SV=2 851 1027 3.0E-09
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 603 907 3.0E-09
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 601 908 3.0E-09
sp|Q4L970|COPA_STAHJ Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 400 624 3.0E-09
sp|Q59465|HMCT_HELPY Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=cadA PE=1 SV=2 848 1029 4.0E-09
sp|Q8ZCA7|COPA_YERPE Copper-exporting P-type ATPase A OS=Yersinia pestis GN=copA PE=3 SV=1 393 637 4.0E-09
sp|Q2YWA3|COPA_STAAB Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=copA PE=3 SV=1 378 621 4.0E-09
sp|Q8NUQ9|COPA_STAAW Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MW2) GN=copA PE=3 SV=1 378 621 6.0E-09
sp|Q6G6B7|COPA_STAAS Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MSSA476) GN=copA PE=3 SV=1 378 621 6.0E-09
sp|A6QK47|COPA_STAAE Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Newman) GN=copA PE=3 SV=1 378 621 6.0E-09
sp|Q5HCZ3|COPA_STAAC Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain COL) GN=copA PE=3 SV=1 378 621 6.0E-09
sp|Q2FV64|COPA_STAA8 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain NCTC 8325) GN=copA PE=1 SV=1 378 621 6.0E-09
sp|A8Z3F8|COPA_STAAT Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copA PE=3 SV=1 378 621 7.0E-09
sp|Q2FDV0|COPA_STAA3 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300) GN=copA PE=3 SV=1 378 621 7.0E-09
sp|P22036|ATMB_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtB PE=1 SV=3 261 622 8.0E-09
sp|Q6GDP1|COPA_STAAR Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MRSA252) GN=copA PE=3 SV=1 378 619 9.0E-09
sp|Q27533|YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans GN=W08D2.5 PE=3 SV=2 905 1110 1.0E-08
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 738 900 2.0E-08
sp|Q9RQB4|HMCT_HELFE Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter felis GN=cadA PE=3 SV=1 848 1029 2.0E-08
sp|Q4A0G1|COPA_STAS1 Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1 378 621 2.0E-08
sp|P58414|CADA_LISMO Probable cadmium-transporting ATPase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cadA PE=3 SV=1 341 621 3.0E-08
sp|Q9XT50|ATP7B_SHEEP Copper-transporting ATPase 2 OS=Ovis aries GN=ATP7B PE=2 SV=1 401 619 4.0E-08
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 603 900 9.0E-08
sp|Q59998|ATZN_SYNY3 Zinc-transporting ATPase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ziaA PE=1 SV=1 848 1029 9.0E-08
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 741 907 1.0E-07
sp|Q9S7J8|HMA7_ARATH Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 392 635 1.0E-07
sp|Q9ZHC7|SILP_SALTM Silver exporting P-type ATPase OS=Salmonella typhimurium GN=silP PE=1 SV=1 388 619 2.0E-07
sp|Q6GIX1|CADA_STAAR Probable cadmium-transporting ATPase OS=Staphylococcus aureus (strain MRSA252) GN=cadA PE=3 SV=1 341 619 2.0E-07
sp|P35670|ATP7B_HUMAN Copper-transporting ATPase 2 OS=Homo sapiens GN=ATP7B PE=1 SV=4 401 619 2.0E-07
sp|Q64446|ATP7B_MOUSE Copper-transporting ATPase 2 OS=Mus musculus GN=Atp7b PE=1 SV=2 401 619 2.0E-07
sp|P38995|ATU2_YEAST Copper-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCC2 PE=1 SV=1 389 624 2.0E-07
sp|Q5ZKB7|AT134_CHICK Probable cation-transporting ATPase 13A4 OS=Gallus gallus GN=ATP13A4 PE=2 SV=1 733 907 3.0E-07
sp|Q8CN02|COPA_STAES Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1 378 630 3.0E-07
sp|Q5HL56|COPA_STAEQ Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1 378 630 3.0E-07
sp|O32220|COPA_BACSU Copper-exporting P-type ATPase A OS=Bacillus subtilis (strain 168) GN=copA PE=1 SV=2 376 627 3.0E-07
sp|P9WPT9|CTPB_MYCTU Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpB PE=1 SV=1 407 634 5.0E-07
sp|P9WPT8|CTPB_MYCTO Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpB PE=3 SV=1 407 634 5.0E-07
sp|P59947|CTPB_MYCBO Cation-transporting P-type ATPase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpB PE=3 SV=1 407 634 5.0E-07
sp|P38360|ATU1_YEAST P-type cation-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCA1 PE=1 SV=2 388 629 6.0E-07
sp|Q64535|ATP7B_RAT Copper-transporting ATPase 2 OS=Rattus norvegicus GN=Atp7b PE=1 SV=1 401 619 6.0E-07
sp|P30336|CADA_BACPE Probable cadmium-transporting ATPase OS=Bacillus pseudofirmus (strain OF4) GN=cadA PE=3 SV=2 341 619 6.0E-07
sp|P9WPS7|CTPG_MYCTU Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpG PE=1 SV=1 847 1006 9.0E-07
sp|P9WPS6|CTPG_MYCTO Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpG PE=3 SV=1 847 1006 9.0E-07
sp|P63690|CTPG_MYCBO Probable cation-transporting ATPase G OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpG PE=3 SV=1 847 1006 9.0E-07
sp|P37386|CADA2_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 341 619 9.0E-07
sp|O32619|COPA_HELFC Copper-transporting ATPase OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=copA PE=3 SV=1 342 618 1.0E-06
sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti (strain 1021) GN=actP2 PE=3 SV=1 351 621 1.0E-06
sp|Q8Z8S4|COPA_SALTI Copper-exporting P-type ATPase A OS=Salmonella typhi GN=copA PE=3 SV=3 393 626 1.0E-06
sp|Q8ZR95|COPA_SALTY Copper-exporting P-type ATPase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=copA PE=1 SV=3 393 626 1.0E-06
sp|P20021|CADA1_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 341 619 1.0E-06
sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=actP PE=1 SV=1 342 621 1.0E-06
sp|A0R3A7|CTPD_MYCS2 Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ctpD PE=1 SV=1 834 1006 2.0E-06
sp|Q60048|CADA_LISMN Probable cadmium-transporting ATPase OS=Listeria monocytogenes GN=cadA PE=1 SV=1 341 619 2.0E-06
sp|Q04656|ATP7A_HUMAN Copper-transporting ATPase 1 OS=Homo sapiens GN=ATP7A PE=1 SV=3 401 634 2.0E-06
sp|P9WPT7|CTPJ_MYCTU Probable cation-transporting P-type ATPase J OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpJ PE=2 SV=1 852 1025 3.0E-06
sp|P9WPT6|CTPJ_MYCTO Probable cation-transporting P-type ATPase J OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpJ PE=3 SV=1 852 1025 3.0E-06
sp|P9WPT3|CTPD_MYCTU Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpD PE=3 SV=1 352 620 7.0E-06
sp|P9WPT2|CTPD_MYCTO Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpD PE=3 SV=1 352 620 7.0E-06
sp|P63686|CTPD_MYCBO Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpD PE=3 SV=1 352 620 7.0E-06
sp|P49015|ATP7A_CRIGR Copper-transporting ATPase 1 (Fragment) OS=Cricetulus griseus GN=ATP7A PE=2 SV=1 401 619 7.0E-06
sp|P46840|CTPB_MYCLE Cation-transporting P-type ATPase B OS=Mycobacterium leprae (strain TN) GN=ctpB PE=3 SV=2 406 628 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 309 330 21
2 340 362 22
3 472 494 22
4 509 531 22
5 552 574 22
6 1015 1037 22
7 1044 1066 22
8 1093 1112 19
9 1169 1191 22
10 1201 1223 22
11 1339 1361 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6151
MPDANDAEPPPGTPPGRRRAPTITIDTTAVSASNSAAEMPQDAHSRPNPSISPQDDAVSPSTVVEPPYGFTSGTQ
QRPEIHADTSFENRDSRPTSPHNVSSPVLSRANDSGAGFLSVPNHLRSRQNSVDSQDAARSVSSHGDTTVVASSY
TQTDKLKGSGNDKIIKDETALAPDAGTEADFEVDDNPFAFTPGQLNKMFNPKSLPAFYKLGGLRGLEKGLRTDRK
TGLSPEETHLDGRVSFEVATAKNDKLATEGAVPSPVARATTTRSSRVRDDAFVDRYRVFRDNRLPEKKGKSLLQL
MWITYNDKVLILLSIAAAISLGVGLYQTFGQDHDENEPKVEWVEGVAIIVAIAIVVIVGSLNDYSKERQFARLNK
KKQDRNVKVVRCGKTMEISVFDIMVGDVVHLEPGDMVPADGVLIEGFNVKCDESQTTGESDIIRKRPADEVYAAI
ENHESLKKMDPLIQSGSRIMEGVGTYMATSTGIYSSYGKTLMALNEDPEMTPLQAKLNVIATYIAKLGGAAGLLL
FIVLFIEFLVRLPRLPETTTPAEKGQMFLNIFIVVVTIIVVAVPEGLPLAVTLALAFATTRMLKDANLVRHLKAC
EVMGNATTICSDKTGTLTQNKMQVVSATIGTSHRFGGARPASRDDDDDDEDEDADDRAATPVDASADISASEFTS
MLSAPVKDLLLKSIALNSTAFEGEVDGEKTFIGSKTETALLLFARAHLAMGPVSEERDNATTLQIIPFDSGRKCM
GIVVQLPKGRARLYVKGASEIVLAKCSQIMRAPAEDDSVTPLSRSNAETITHLIESYALRSLRTIGISYRDFEAW
PPKAGRRGDGGKNEIEFEDIFRDMSFIGMVGIQDPLRDGVYESVKLCQKAGVVVRMVTGDNKLTAQAIAKECGIL
QPNSIVLEGPEFRNLSKLQQEEIIPKLHVLARSSPEDKRILVKRLKDKGETVAVTGDGTNDAPALKMADVGFSMG
IAGTEVAKEASAIILMDDNFSSIVKALKWGRAVNDAVKRFLQFQLTVNVTAVILTFVTAVSSGKEQSVLTAVQLL
WVNLIMDTLAALALATDPPQDSVLERKPEAKGASIISTTMWKMILGQAIYQLVITFLLYYGVPKGLIDGIISNDP
LPADQVNTLVFNTFVWMQIFNQWNNRRLDNMFNIFEGLTKNWFFIAVSAIMCGGQVLIIFVGGAAFSIAKGGQDS
ALWGIAIILGFLSIPVGVVIRLIPDSIILALVPDFLKQRAHRVPGLTVSDEEMDMYPEPLADVRDELNFLRRMKG
GRLNNLKFAIQHPKETLRQRSRSPSHSRSGSMNGPQTPTREDSFGSRAATPESRKRSRSTRSRSNSALGAPTVMA
GIVAAGVAAGWSPVGRVNPEEREENESRPSRRRSEAGDAQNHSEAQ*
Coding >Hirsu2|6151
ATGCCCGACGCCAATGACGCTGAGCCCCCCCCTGGTACTCCGCCTGGACGGAGAAGAGCGCCAACCATCACCATT
GATACCACGGCCGTCAGCGCCAGTAACAGCGCTGCCGAGATGCCCCAAGACGCGCACTCGCGACCGAACCCGTCC
ATATCGCCCCAAGACGACGCCGTGAGCCCGTCGACCGTCGTCGAGCCCCCCTACGGCTTCACCTCTGGCACCCAG
CAGCGCCCCGAGATCCATGCCGACACCTCGTTCGAAAACAGAGACAGCCGCCCCACGAGCCCTCACAATGTCTCG
AGCCCCGTCCTGTCGCGCGCCAACGACAGCGGCGCTGGCTTCTTGTCGGTGCCCAACCACCTGCGGTCGAGGCAG
AACTCGGTCGACTCGCAGGACGCGGCCCGGTCCGTCAGTTCCCACGGCGACACGACTGTGGTCGCGTCCAGCTAC
ACCCAGACTGATAAGCTCAAGGGGTCGGGCAATGATAAGATCATCAAGGACGAGACTGCTCTGGCCCCGGACGCC
GGCACCGAGGCCGACTTCGAGGTGGACGACAACCCCTTCGCCTTTACCCCCGGCCAGCTCAACAAGATGTTCAAC
CCCAAGAGCTTGCCTGCATTCTACAAGCTTGGTGGCCTGCGCGGGCTCGAGAAGGGCTTGAGGACGGATCGCAAG
ACTGGGCTGAGCCCAGAGGAGACCCATCTCGACGGGCGCGTTTCCTTCGAGGTCGCCACTGCCAAGAACGACAAG
TTGGCGACGGAGGGTGCTGTTCCCAGCCCAGTTGCCCGCGCGACGACGACCAGGTCGTCCCGTGTAAGAGACGAC
GCCTTCGTCGACCGATATCGCGTCTTCCGTGACAACCGTCTGCCGGAGAAGAAGGGCAAGAGCTTGCTCCAGCTC
ATGTGGATCACCTACAACGACAAGGTCCTCATCCTGCTGTCGATTGCCGCCGCTATTAGTCTCGGCGTCGGACTT
TACCAAACCTTTGGTCAGGATCACGATGAGAATGAGCCCAAGGTGGAGTGGGTCGAGGGCGTTGCCATCATTGTT
GCCATCGCCATCGTCGTCATCGTCGGTTCGCTCAACGACTATTCCAAGGAACGTCAGTTCGCCCGGTTGAACAAG
AAGAAACAGGACCGCAATGTCAAGGTGGTGCGCTGCGGCAAGACGATGGAGATATCCGTCTTCGACATCATGGTT
GGCGATGTGGTCCATTTGGAGCCTGGCGACATGGTTCCCGCCGACGGCGTGCTTATCGAAGGCTTCAACGTCAAA
TGCGACGAGTCACAGACGACGGGCGAGTCAGACATCATCCGTAAACGACCCGCCGACGAAGTCTACGCCGCCATC
GAGAACCACGAGAGCTTGAAGAAGATGGACCCCTTGATCCAGTCCGGCTCTCGCATCATGGAGGGCGTCGGCACC
TACATGGCCACGTCGACCGGCATCTACTCCTCCTACGGCAAGACGCTCATGGCCCTCAACGAGGACCCCGAGATG
ACACCCCTACAGGCCAAGCTCAACGTCATCGCCACCTACATCGCCAAGTTGGGTGGTGCTGCTGGCCTGTTGCTG
TTCATCGTCCTGTTCATCGAATTCCTCGTCCGCCTGCCTCGCCTTCCGGAAACAACGACGCCGGCGGAGAAGGGC
CAGATGTTCCTCAACATCTTCATTGTGGTCGTGACCATCATTGTCGTCGCTGTGCCCGAAGGGCTCCCCTTGGCC
GTGACGCTCGCCTTGGCCTTCGCCACCACTCGCATGCTCAAGGACGCCAACTTGGTCCGGCATCTCAAAGCCTGC
GAAGTCATGGGCAACGCCACCACCATCTGTTCCGACAAGACGGGCACCTTGACTCAAAACAAGATGCAAGTCGTA
TCGGCCACTATCGGAACGAGCCACAGGTTCGGCGGCGCCCGGCCGGCGTCGAGGGACGACGACGACGACGACGAA
GATGAGGACGCCGACGATAGAGCCGCGACGCCCGTGGATGCCAGCGCGGATATCTCTGCGTCCGAGTTCACGTCC
ATGCTCAGCGCTCCCGTCAAGGACCTGCTGCTGAAGTCGATTGCCCTCAACTCGACGGCTTTCGAGGGGGAGGTT
GATGGGGAGAAGACGTTCATCGGATCCAAGACCGAGACGGCCCTGCTGCTTTTCGCCAGGGCGCACCTGGCCATG
GGCCCGGTCAGCGAGGAGCGAGACAACGCCACGACGCTCCAGATCATTCCCTTCGACTCGGGCCGGAAGTGCATG
GGCATCGTCGTTCAGCTGCCCAAGGGCAGGGCCCGGCTCTACGTCAAAGGCGCCTCCGAAATCGTGCTCGCCAAG
TGCAGCCAAATCATGCGGGCCCCTGCCGAAGACGACTCCGTCACGCCTCTCTCGCGCAGCAATGCGGAGACGATC
ACGCATCTGATTGAGAGCTACGCCTTGCGCTCCCTCCGGACCATCGGCATCTCTTATCGGGACTTTGAGGCCTGG
CCGCCTAAGGCAGGCCGGCGCGGGGATGGCGGCAAGAACGAAATCGAGTTCGAGGATATCTTCCGGGACATGTCC
TTCATCGGCATGGTCGGCATTCAGGACCCCTTACGGGACGGCGTCTATGAGTCGGTCAAGCTGTGCCAGAAGGCC
GGCGTCGTGGTCCGGATGGTGACGGGCGACAACAAGCTCACGGCCCAGGCCATCGCCAAGGAGTGCGGCATACTG
CAGCCCAACAGCATCGTCCTGGAGGGCCCCGAATTCCGCAACCTGAGCAAGCTCCAGCAAGAGGAGATCATCCCG
AAGCTGCACGTTCTGGCCAGGTCCAGCCCCGAGGACAAGCGCATCCTGGTCAAGAGACTCAAGGACAAGGGCGAG
ACGGTGGCTGTGACGGGCGACGGCACCAACGACGCGCCTGCACTGAAGATGGCTGACGTCGGCTTCTCCATGGGC
ATCGCCGGCACCGAGGTGGCCAAGGAGGCATCGGCCATTATCCTGATGGACGACAACTTCTCCAGCATTGTCAAG
GCGCTCAAGTGGGGACGCGCCGTCAACGACGCCGTCAAGCGCTTCCTGCAGTTCCAGCTGACGGTCAACGTGACG
GCCGTCATCCTCACCTTCGTGACGGCCGTTTCCAGCGGAAAGGAGCAGTCGGTCCTGACGGCGGTGCAGCTGCTA
TGGGTCAACCTCATCATGGACACACTGGCGGCGCTGGCCCTGGCCACGGACCCGCCGCAGGACAGCGTCTTGGAG
AGGAAACCCGAAGCCAAGGGCGCGTCGATAATCTCGACGACGATGTGGAAGATGATTCTGGGCCAGGCCATCTAC
CAGCTCGTCATCACCTTCCTCCTCTATTACGGGGTTCCAAAGGGCCTCATCGACGGCATTATCAGTAACGACCCC
CTGCCCGCCGATCAGGTCAATACGCTGGTGTTCAACACGTTTGTCTGGATGCAGATCTTCAACCAATGGAACAAC
CGGCGCCTGGACAACATGTTCAACATATTCGAAGGTTTGACGAAGAACTGGTTCTTCATTGCCGTGAGCGCCATT
ATGTGCGGCGGTCAAGTGTTGATCATCTTCGTGGGAGGCGCAGCTTTCTCCATCGCCAAGGGCGGACAGGATTCG
GCCTTGTGGGGAATCGCCATCATCCTCGGCTTCCTCTCGATCCCCGTGGGCGTGGTGATCCGACTGATCCCGGAC
AGCATCATCCTGGCACTCGTACCCGACTTCCTCAAGCAGCGGGCTCACCGGGTTCCGGGCCTGACGGTGTCGGAC
GAAGAGATGGACATGTATCCGGAGCCGCTGGCGGACGTGCGGGACGAGCTCAACTTTCTCCGGCGGATGAAGGGT
GGCCGGCTGAATAATTTGAAGTTTGCGATCCAGCACCCCAAGGAGACGCTCCGCCAACGATCGAGAAGCCCGTCG
CACTCACGGTCGGGCTCGATGAATGGGCCGCAGACGCCGACGCGGGAGGACAGCTTCGGGTCGCGGGCGGCGACG
CCAGAGTCGCGGAAGCGGTCGAGATCGACGCGGTCGCGGTCCAACTCGGCGCTGGGGGCGCCGACGGTCATGGCG
GGCATCGTGGCCGCGGGCGTGGCCGCGGGCTGGTCGCCCGTGGGCCGGGTGAACCCAGAAGAGCGGGAGGAGAAC
GAGTCACGGCCGAGTCGGAGGAGAAGCGAAGCAGGCGATGCACAAAATCACAGCGAGGCGCAATGA
Transcript >Hirsu2|6151
ATGCCCGACGCCAATGACGCTGAGCCCCCCCCTGGTACTCCGCCTGGACGGAGAAGAGCGCCAACCATCACCATT
GATACCACGGCCGTCAGCGCCAGTAACAGCGCTGCCGAGATGCCCCAAGACGCGCACTCGCGACCGAACCCGTCC
ATATCGCCCCAAGACGACGCCGTGAGCCCGTCGACCGTCGTCGAGCCCCCCTACGGCTTCACCTCTGGCACCCAG
CAGCGCCCCGAGATCCATGCCGACACCTCGTTCGAAAACAGAGACAGCCGCCCCACGAGCCCTCACAATGTCTCG
AGCCCCGTCCTGTCGCGCGCCAACGACAGCGGCGCTGGCTTCTTGTCGGTGCCCAACCACCTGCGGTCGAGGCAG
AACTCGGTCGACTCGCAGGACGCGGCCCGGTCCGTCAGTTCCCACGGCGACACGACTGTGGTCGCGTCCAGCTAC
ACCCAGACTGATAAGCTCAAGGGGTCGGGCAATGATAAGATCATCAAGGACGAGACTGCTCTGGCCCCGGACGCC
GGCACCGAGGCCGACTTCGAGGTGGACGACAACCCCTTCGCCTTTACCCCCGGCCAGCTCAACAAGATGTTCAAC
CCCAAGAGCTTGCCTGCATTCTACAAGCTTGGTGGCCTGCGCGGGCTCGAGAAGGGCTTGAGGACGGATCGCAAG
ACTGGGCTGAGCCCAGAGGAGACCCATCTCGACGGGCGCGTTTCCTTCGAGGTCGCCACTGCCAAGAACGACAAG
TTGGCGACGGAGGGTGCTGTTCCCAGCCCAGTTGCCCGCGCGACGACGACCAGGTCGTCCCGTGTAAGAGACGAC
GCCTTCGTCGACCGATATCGCGTCTTCCGTGACAACCGTCTGCCGGAGAAGAAGGGCAAGAGCTTGCTCCAGCTC
ATGTGGATCACCTACAACGACAAGGTCCTCATCCTGCTGTCGATTGCCGCCGCTATTAGTCTCGGCGTCGGACTT
TACCAAACCTTTGGTCAGGATCACGATGAGAATGAGCCCAAGGTGGAGTGGGTCGAGGGCGTTGCCATCATTGTT
GCCATCGCCATCGTCGTCATCGTCGGTTCGCTCAACGACTATTCCAAGGAACGTCAGTTCGCCCGGTTGAACAAG
AAGAAACAGGACCGCAATGTCAAGGTGGTGCGCTGCGGCAAGACGATGGAGATATCCGTCTTCGACATCATGGTT
GGCGATGTGGTCCATTTGGAGCCTGGCGACATGGTTCCCGCCGACGGCGTGCTTATCGAAGGCTTCAACGTCAAA
TGCGACGAGTCACAGACGACGGGCGAGTCAGACATCATCCGTAAACGACCCGCCGACGAAGTCTACGCCGCCATC
GAGAACCACGAGAGCTTGAAGAAGATGGACCCCTTGATCCAGTCCGGCTCTCGCATCATGGAGGGCGTCGGCACC
TACATGGCCACGTCGACCGGCATCTACTCCTCCTACGGCAAGACGCTCATGGCCCTCAACGAGGACCCCGAGATG
ACACCCCTACAGGCCAAGCTCAACGTCATCGCCACCTACATCGCCAAGTTGGGTGGTGCTGCTGGCCTGTTGCTG
TTCATCGTCCTGTTCATCGAATTCCTCGTCCGCCTGCCTCGCCTTCCGGAAACAACGACGCCGGCGGAGAAGGGC
CAGATGTTCCTCAACATCTTCATTGTGGTCGTGACCATCATTGTCGTCGCTGTGCCCGAAGGGCTCCCCTTGGCC
GTGACGCTCGCCTTGGCCTTCGCCACCACTCGCATGCTCAAGGACGCCAACTTGGTCCGGCATCTCAAAGCCTGC
GAAGTCATGGGCAACGCCACCACCATCTGTTCCGACAAGACGGGCACCTTGACTCAAAACAAGATGCAAGTCGTA
TCGGCCACTATCGGAACGAGCCACAGGTTCGGCGGCGCCCGGCCGGCGTCGAGGGACGACGACGACGACGACGAA
GATGAGGACGCCGACGATAGAGCCGCGACGCCCGTGGATGCCAGCGCGGATATCTCTGCGTCCGAGTTCACGTCC
ATGCTCAGCGCTCCCGTCAAGGACCTGCTGCTGAAGTCGATTGCCCTCAACTCGACGGCTTTCGAGGGGGAGGTT
GATGGGGAGAAGACGTTCATCGGATCCAAGACCGAGACGGCCCTGCTGCTTTTCGCCAGGGCGCACCTGGCCATG
GGCCCGGTCAGCGAGGAGCGAGACAACGCCACGACGCTCCAGATCATTCCCTTCGACTCGGGCCGGAAGTGCATG
GGCATCGTCGTTCAGCTGCCCAAGGGCAGGGCCCGGCTCTACGTCAAAGGCGCCTCCGAAATCGTGCTCGCCAAG
TGCAGCCAAATCATGCGGGCCCCTGCCGAAGACGACTCCGTCACGCCTCTCTCGCGCAGCAATGCGGAGACGATC
ACGCATCTGATTGAGAGCTACGCCTTGCGCTCCCTCCGGACCATCGGCATCTCTTATCGGGACTTTGAGGCCTGG
CCGCCTAAGGCAGGCCGGCGCGGGGATGGCGGCAAGAACGAAATCGAGTTCGAGGATATCTTCCGGGACATGTCC
TTCATCGGCATGGTCGGCATTCAGGACCCCTTACGGGACGGCGTCTATGAGTCGGTCAAGCTGTGCCAGAAGGCC
GGCGTCGTGGTCCGGATGGTGACGGGCGACAACAAGCTCACGGCCCAGGCCATCGCCAAGGAGTGCGGCATACTG
CAGCCCAACAGCATCGTCCTGGAGGGCCCCGAATTCCGCAACCTGAGCAAGCTCCAGCAAGAGGAGATCATCCCG
AAGCTGCACGTTCTGGCCAGGTCCAGCCCCGAGGACAAGCGCATCCTGGTCAAGAGACTCAAGGACAAGGGCGAG
ACGGTGGCTGTGACGGGCGACGGCACCAACGACGCGCCTGCACTGAAGATGGCTGACGTCGGCTTCTCCATGGGC
ATCGCCGGCACCGAGGTGGCCAAGGAGGCATCGGCCATTATCCTGATGGACGACAACTTCTCCAGCATTGTCAAG
GCGCTCAAGTGGGGACGCGCCGTCAACGACGCCGTCAAGCGCTTCCTGCAGTTCCAGCTGACGGTCAACGTGACG
GCCGTCATCCTCACCTTCGTGACGGCCGTTTCCAGCGGAAAGGAGCAGTCGGTCCTGACGGCGGTGCAGCTGCTA
TGGGTCAACCTCATCATGGACACACTGGCGGCGCTGGCCCTGGCCACGGACCCGCCGCAGGACAGCGTCTTGGAG
AGGAAACCCGAAGCCAAGGGCGCGTCGATAATCTCGACGACGATGTGGAAGATGATTCTGGGCCAGGCCATCTAC
CAGCTCGTCATCACCTTCCTCCTCTATTACGGGGTTCCAAAGGGCCTCATCGACGGCATTATCAGTAACGACCCC
CTGCCCGCCGATCAGGTCAATACGCTGGTGTTCAACACGTTTGTCTGGATGCAGATCTTCAACCAATGGAACAAC
CGGCGCCTGGACAACATGTTCAACATATTCGAAGGTTTGACGAAGAACTGGTTCTTCATTGCCGTGAGCGCCATT
ATGTGCGGCGGTCAAGTGTTGATCATCTTCGTGGGAGGCGCAGCTTTCTCCATCGCCAAGGGCGGACAGGATTCG
GCCTTGTGGGGAATCGCCATCATCCTCGGCTTCCTCTCGATCCCCGTGGGCGTGGTGATCCGACTGATCCCGGAC
AGCATCATCCTGGCACTCGTACCCGACTTCCTCAAGCAGCGGGCTCACCGGGTTCCGGGCCTGACGGTGTCGGAC
GAAGAGATGGACATGTATCCGGAGCCGCTGGCGGACGTGCGGGACGAGCTCAACTTTCTCCGGCGGATGAAGGGT
GGCCGGCTGAATAATTTGAAGTTTGCGATCCAGCACCCCAAGGAGACGCTCCGCCAACGATCGAGAAGCCCGTCG
CACTCACGGTCGGGCTCGATGAATGGGCCGCAGACGCCGACGCGGGAGGACAGCTTCGGGTCGCGGGCGGCGACG
CCAGAGTCGCGGAAGCGGTCGAGATCGACGCGGTCGCGGTCCAACTCGGCGCTGGGGGCGCCGACGGTCATGGCG
GGCATCGTGGCCGCGGGCGTGGCCGCGGGCTGGTCGCCCGTGGGCCGGGTGAACCCAGAAGAGCGGGAGGAGAAC
GAGTCACGGCCGAGTCGGAGGAGAAGCGAAGCAGGCGATGCACAAAATCACAGCGAGGCGCAATGA
Gene >Hirsu2|6151
ATGCCCGACGCCAATGACGCTGAGCCCCCCCCTGGTACTCCGCCTGGACGGAGAAGAGCGTAAGGCCCGACCTCC
GAGCATCCATATCTAGACCCGGACCGCTTCCCCGGTTGCCGGGAACACTCCTAACCGTCACTGCGCAGGCCAACC
ATCACCATTGATACCACGGCCGTCAGCGCCAGTAACAGCGCTGCCGAGATGCCCCAAGACGCGCACTCGCGACCG
AACCCGTCCATATCGCCCCAAGACGACGCCGTGAGCCCGTCGACCGTCGTCGAGCCCCCCTACGGCTTCACCTCT
GGCACCCAGCAGCGCCCCGAGATCCATGCCGACACCTCGTTCGAAAACAGAGACAGCCGCCCCACGAGCCCTCAC
AATGTCTCGAGCCCCGTCCTGTCGCGCGCCAACGACAGCGGCGCTGGCTTCTTGTCGGTGCCCAACCACCTGCGG
TCGAGGCAGAACTCGGTCGACTCGCAGGACGCGGCCCGGTCCGTCAGTTCCCACGGCGACACGACTGTGGTCGCG
TCCAGCTACACCCAGACTGATAAGCTCAAGGGGTCGGGCAATGATAAGATCATCAAGGACGAGACTGCTCTGGCC
CCGGACGCCGGCACCGAGGCCGACTTCGAGGTGGACGACAACCCCTTCGCCTTTACCCCCGGCCAGCTCAACAAG
ATGTTCAACCCCAAGAGCTTGCCTGCATTCTACAAGCTTGGTGGCCTGCGCGGGCTCGAGAAGGGCTTGAGGACG
GATCGCAAGACTGGGCTGAGCCCAGAGGAGACCCATCTCGACGGGCGCGTTTCCTTCGAGGTCGCCACTGCCAAG
AACGACAAGTTGGCGACGGAGGGTGCTGTTCCCAGCCCAGTTGCCCGCGCGACGACGACCAGGTCGTCCCGTGTA
AGAGACGACGCCTTCGTCGACCGATATCGCGTCTTCCGTGACAACCGTCTGCCGGAGAAGAAGGGCAAGAGCTTG
CTCCAGCTCATGTGGATCACCTACAACGACAAGGTCCTCATCCTGCTGTCGATTGCCGCCGCTATTAGTCTCGGC
GTCGGACTTTACCAAACCTTTGGTCAGGATCACGATGAGAATGAGCCCAAGGTGGAGTGGGTCGAGGGCGTTGCC
ATCATTGTTGCCATCGCCATCGTCGTCATCGTCGGTTCGCTCAACGACTATTCCAAGGAACGTCAGTTCGCCCGG
TTGAACAAGAAGAAACAGGACCGCAATGTCAAGGTGGTGCGCTGCGGCAAGACGATGGAGATATCCGTCTTCGAC
ATCATGGTTGGCGATGTGGTCCATTTGGAGCCTGGCGACATGGTTCCCGCCGACGGCGTGCTTATCGAAGGCTTC
AACGTCAAATGCGACGAGTCACAGACGACGGGCGAGTCAGACATCATCCGTAAACGACCCGCCGACGAAGTCTAC
GCCGCCATCGAGAACCACGAGAGCTTGAAGAAGATGGACCCCTTGATCCAGTCCGGCTCTCGCATCATGGAGGGC
GTCGGCACCTACATGGCCACGTCGACCGGCATCTACTCCTCCTACGGCAAGACGCTCATGGCCCTCAACGAGGAC
CCCGAGATGACACCCCTACAGGCCAAGCTCAACGTCATCGCCACCTACATCGCCAAGTTGGGTGGTGCTGCTGGC
CTGTTGCTGTTCATCGTCCTGTTCATCGAATTCCTCGTCCGCCTGCCTCGCCTTCCGGAAACAACGACGCCGGCG
GAGAAGGGCCAGATGTTCCTCAACATCTTCATTGTGGTCGTGACCATCATTGTCGTCGCTGTGCCCGAAGGGCTC
CCCTTGGCCGTGACGCTCGCCTTGGCCTTCGCCACCACTCGCATGCTCAAGGACGCCAACTTGGTCCGGCATCTC
AAAGCCTGCGAAGTCATGGGCAACGCCACCACCATCTGTTCCGACAAGACGGGCACCTTGACTCAAAACAAGATG
CAAGTCGTATCGGCCACTATCGGAACGAGCCACAGGTTCGGCGGCGCCCGGCCGGCGTCGAGGGACGACGACGAC
GACGACGAAGATGAGGACGCCGACGATAGAGCCGCGACGCCCGTGGATGCCAGCGCGGATATCTCTGCGTCCGAG
TTCACGTCCATGCTCAGCGCTCCCGTCAAGGACCTGCTGCTGAAGTCGATTGCCCTCAACTCGACGGCTTTCGAG
GGGGAGGTTGATGGGGAGAAGACGTTCATCGGATCCAAGACCGAGACGGCCCTGCTGCTTTTCGCCAGGGCGCAC
CTGGCCATGGGCCCGGTCAGCGAGGAGCGAGACAACGCCACGACGCTCCAGATCATTCCCTTCGACTCGGGCCGG
AAGTGCATGGGCATCGTCGTTCAGCTGCCCAAGGGCAGGGCCCGGCTCTACGTCAAAGGCGCCTCCGAAATCGTG
CTCGCCAAGTGCAGCCAAATCATGCGGGCCCCTGCCGAAGACGACTCCGTCACGCCTCTCTCGCGCAGCAATGCG
GAGACGATCACGCATCTGATTGAGAGCTACGCCTTGCGCTCCCTCCGGACCATCGGCATCTCTTATCGGGACTTT
GAGGCCTGGCCGCCTAAGGCAGGCCGGCGCGGGGATGGCGGCAAGAACGAAATCGAGTTCGAGGATATCTTCCGG
GACATGTCCTTCATCGGCATGGTCGGCATTCAGGACCCCTTACGGGACGGCGTCTATGAGTCGGTCAAGCTGTGC
CAGAAGGCCGGCGTCGTGGTCCGGATGGTGACGGGCGACAACAAGCTCACGGCCCAGGCCATCGCCAAGGAGTGC
GGCATACTGCAGCCCAACAGCATCGTCCTGGAGGGCCCCGAATTCCGCAACCTGAGCAAGCTCCAGCAAGAGGAG
ATCATCCCGAAGCTGCACGTTCTGGCCAGGTCCAGCCCCGAGGACAAGCGCATCCTGGTCAAGAGACTCAAGGAC
AAGGGCGAGACGGTGGCTGTGACGGGCGACGGCACCAACGACGCGCCTGCACTGAAGATGGCTGACGTCGGCTTC
TCCATGGGCATCGCCGGCACCGAGGTGGCCAAGGAGGCATCGGCCATTATCCTGATGGACGACAACTTCTCCAGC
ATTGTCAAGGCGCTCAAGTGGGGACGCGCCGTCAACGACGCCGTCAAGCGCTTCCTGCAGTTCCAGCTGACGGTC
AACGTGACGGCCGTCATCCTCACCTTCGTGACGGCCGTTTCCAGCGGAAAGGAGCAGTCGGTCCTGACGGCGGTG
CAGCTGCTATGGGTCAACCTCATCATGGACACACTGGCGGCGCTGGCCCTGGCCACGGACCCGCCGCAGGACAGC
GTCTTGGAGAGGAAACCCGAAGCCAAGGGCGCGTCGATAATCTCGACGACGATGTGGAAGATGATTCTGGGCCAG
GCCATCTACCAGCTCGTCATCACCTTCCTCCTCTATTACGGGGTTCCAAAGGGCCTCATCGACGGCATTATCAGT
AACGACCCCCTGCCCGCCGATCAGGTCAATACGCTGGTGTTCAACACGTTTGTCTGGATGCAGATCTTCAACCAA
TGGAAGTAAGTGGACTCGGCCCCCCCCTCCTCAATGCAACGATGAGGCATTAACTGGTGGGCACAGCAACCGGCG
CCTGGACAACATGTTCAACATATTCGAAGGTTTGACGAAGAACTGGTTCTTCATTGCCGTGAGCGCCATTATGTG
CGGCGGTCAAGTGTTGATCATCTTCGTGGGAGGCGCAGCTTTCTCCATCGCCAAGGGCGGACAGGATTCGGCCTT
GTGGGGAATCGCCATCATCCTCGGCTTCCTCTCGATCCCCGTGGGCGTGGTGATCCGACTGATCCCGGACAGCAT
CATCCTGGCACTCGTACCCGACTTCCTCAAGCAGCGGGCTCACCGGGTTCCGGGCCTGACGGTGTCGGACGAAGA
GATGGACATGTATCCGGAGCCGCTGGCGGACGTGCGGGACGAGCTCAACTTTCTCCGGCGGATGAAGGGTGGCCG
GCTGAATAATTTGAAGTTTGCGATCCAGCACCCCAAGGAGACGCTCCGCCAACGATCGAGAAGCCCGTCGCACTC
ACGGTCGGGCTCGATGAATGGGCCGCAGACGCCGACGCGGGAGGACAGCTTCGGGTCGCGGGCGGCGACGCCAGA
GTCGCGGAAGCGGTCGAGATCGACGCGGTCGCGGTCCAACTCGGCGCTGGGGGCGCCGACGGTCATGGCGGGCAT
CGTGGCCGCGGGCGTGGCCGCGGGCTGGTCGCCCGTGGGCCGGGTGAACCCAGAAGAGCGGGAGGAGAACGAGTC
ACGGCCGAGTCGGAGGAGAAGCGAAGCAGGCGATGCACAAAATCACAGCGAGGCGCAATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail