Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|615
Gene name
LocationContig_1121:5477..7462
Strand+
Gene length (bp)1985
Transcript length (bp)1911
Coding sequence length (bp)1911
Protein length (aa) 637

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 1.8E-14 218 420
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.4E-10 216 419
PF00743 FMO-like Flavin-binding monooxygenase-like 7.1E-12 217 427
PF13434 K_oxygenase L-lysine 6-monooxygenase (NADPH-requiring) 3.5E-07 299 427
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.3E-06 219 255
PF01494 FAD_binding_3 FAD binding domain 3.8E-05 216 248

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA4 OS=Arabidopsis thaliana GN=YUC4 PE=1 SV=1 215 561 3.0E-26
sp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=1 SV=1 218 561 9.0E-26
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 218 561 2.0E-25
sp|Q9LPL3|YUC11_ARATH Probable indole-3-pyruvate monooxygenase YUCCA11 OS=Arabidopsis thaliana GN=YUC11 PE=2 SV=1 209 565 6.0E-25
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 218 561 6.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA4 OS=Arabidopsis thaliana GN=YUC4 PE=1 SV=1 215 561 3.0E-26
sp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=1 SV=1 218 561 9.0E-26
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 218 561 2.0E-25
sp|Q9LPL3|YUC11_ARATH Probable indole-3-pyruvate monooxygenase YUCCA11 OS=Arabidopsis thaliana GN=YUC11 PE=2 SV=1 209 565 6.0E-25
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 218 561 6.0E-24
sp|O49312|YUC7_ARATH Probable indole-3-pyruvate monooxygenase YUCCA7 OS=Arabidopsis thaliana GN=YUC7 PE=2 SV=1 218 561 3.0E-23
sp|Q9FVQ0|YUC10_ARATH Probable indole-3-pyruvate monooxygenase YUCCA10 OS=Arabidopsis thaliana GN=YUC10 PE=2 SV=1 214 561 6.0E-23
sp|O64489|YUC9_ARATH Probable indole-3-pyruvate monooxygenase YUCCA9 OS=Arabidopsis thaliana GN=YUC9 PE=2 SV=1 218 561 2.0E-22
sp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=1 SV=1 215 561 3.0E-22
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 218 561 1.0E-21
sp|Q8VZ59|YUC6_ARATH Indole-3-pyruvate monooxygenase YUCCA6 OS=Arabidopsis thaliana GN=YUC6 PE=1 SV=1 218 561 5.0E-20
sp|Q5L2G3|CZCO_GEOKA Uncharacterized oxidoreductase CzcO-like OS=Geobacillus kaustophilus (strain HTA426) GN=GK0582 PE=4 SV=1 217 409 4.0E-12
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 212 560 4.0E-10
sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 217 428 6.0E-10
sp|Q99518|FMO2_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4 217 428 2.0E-09
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 217 466 2.0E-09
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 217 428 3.0E-09
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 217 428 3.0E-09
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 217 428 3.0E-09
sp|P31512|FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens GN=FMO4 PE=1 SV=3 217 428 3.0E-09
sp|O60774|FMO6_HUMAN Putative dimethylaniline monooxygenase [N-oxide-forming] 6 OS=Homo sapiens GN=FMO6P PE=5 SV=1 219 425 4.0E-09
sp|O07085|CZCO_BACSU Uncharacterized oxidoreductase CzcO OS=Bacillus subtilis (strain 168) GN=czcO PE=1 SV=1 218 310 5.0E-09
sp|P97501|FMO3_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Mus musculus GN=Fmo3 PE=1 SV=1 217 425 8.0E-09
sp|A7Z1S7|CZCO_BACMF Uncharacterized oxidoreductase CzcO OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=czcO PE=3 SV=1 218 310 1.0E-08
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 217 559 1.0E-08
sp|Q9EQ76|FMO3_RAT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Rattus norvegicus GN=Fmo3 PE=1 SV=1 217 425 2.0E-08
sp|Q8K2I3|FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus GN=Fmo2 PE=1 SV=3 217 559 3.0E-08
sp|Q95LA1|FMO3_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Canis lupus familiaris GN=FMO3 PE=2 SV=3 217 425 8.0E-08
sp|Q8SPQ7|FMO3_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Macaca mulatta GN=FMO3 PE=2 SV=3 217 425 1.0E-07
sp|P36367|FMO4_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Oryctolagus cuniculus GN=FMO4 PE=2 SV=2 217 428 2.0E-07
sp|Q8K4C0|FMO5_RAT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Rattus norvegicus GN=Fmo5 PE=1 SV=3 217 425 4.0E-07
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 217 425 5.0E-07
sp|Q88J44|BVMO_PSEPK Baeyer-Villiger monooxygenase OS=Pseudomonas putida (strain KT2440) GN=PP_2805 PE=1 SV=1 217 425 6.0E-07
sp|Q6IRI9|FMO2_RAT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Rattus norvegicus GN=Fmo2 PE=2 SV=3 217 559 1.0E-06
sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus GN=Fmo5 PE=1 SV=4 217 425 2.0E-06
sp|P49109|FMO5_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Cavia porcellus GN=FMO5 PE=2 SV=2 213 425 3.0E-06
sp|Q47PU3|PAMO_THEFY Phenylacetone monooxygenase OS=Thermobifida fusca (strain YX) GN=pamO PE=1 SV=1 214 434 4.0E-06
sp|Q8VHG0|FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus GN=Fmo4 PE=1 SV=3 217 560 4.0E-06
sp|H3JQW0|OTEMO_PSEPU 2-oxo-Delta(3)-4,5,5-trimethylcyclopentenylacetyl-CoA monooxygenase OS=Pseudomonas putida GN=otemo PE=1 SV=1 218 424 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0071949 FAD binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0050661 NADP binding Yes
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0048037 cofactor binding No
GO:0050662 coenzyme binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0004497 monooxygenase activity No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|615
MATAAMEVPPPAAQRSHEWVNVPIAEIPSSAPADSADARAGATGVLDALNRALSQRDYAAVSQLFIKGGFWRDHL
CLSWEFRAAQGRDKILDFLQSCARSRDGFRLKKLSLDTSIAPSRQPQLAPFDVEGKSRGIQAIFLVDTTIGSGQG
VMRLVMDGGQWRIFTLYTTLCELKGHGENTFHRRPRGVDSTVTPDRDDWATIRKRQTDFEDGTEPAVIVVGAGQA
GLSIAARLKSLGVRVLIIDRNERVGDSWRKRYRHLVLHDVVWYDHMPYLSFPPQWPVFAPKDKLANFLESYADIL
ELDVWTQAELQKSEWDDKTGAWTVVISRKTKDGSSQTRTFHPRHIIQATGHSGLKKHPAFAGADGFKGDRLCHSS
EFPGAPEKGGSGKKAVVIGSCNSAHDIAQDYLENGYEVTMVQRSGTYVVSTSSILDIAFKGLYDQDGPPVEDADL
LAESLPGSVLKAVHAQVTALQRENDKETLSGLAKAGFKAHSGPDGAGIFFQYLQYGGGYYIDVGGCRLIADGKIK
VKQGQEVEQILPHGVRLADGSELPADEIVLATGYQTMESQTRHLFGDKVADRVHGVFGFNDEGEIRTVWQQSGHP
GFWYHGGNLAFCRFYSRLLALQIKGLEEGLYGYGEI*
Coding >Hirsu2|615
ATGGCCACGGCGGCGATGGAAGTTCCGCCGCCCGCGGCCCAACGCTCTCACGAATGGGTCAACGTCCCGATCGCC
GAGATCCCCTCGTCGGCTCCGGCCGACTCGGCCGATGCTCGCGCCGGGGCGACGGGCGTGCTCGACGCCCTGAAC
CGGGCCCTTTCGCAGCGTGACTACGCAGCTGTCTCGCAGCTCTTCATCAAGGGCGGCTTCTGGCGCGACCACCTG
TGCTTGTCGTGGGAGTTCCGGGCGGCCCAGGGCCGGGACAAGATCCTCGACTTCCTCCAGAGCTGCGCCAGATCC
CGGGACGGGTTCCGGCTGAAGAAGCTGAGCCTCGACACCAGCATCGCCCCGTCTCGGCAGCCGCAGCTCGCGCCG
TTCGACGTCGAGGGCAAGTCCCGAGGGATTCAGGCCATCTTTCTGGTCGACACCACCATCGGTTCGGGCCAGGGC
GTCATGCGACTGGTTATGGACGGGGGCCAATGGCGCATCTTCACCCTCTATACGACTCTGTGCGAACTCAAGGGA
CACGGCGAGAATACCTTCCACCGCCGGCCACGGGGCGTTGATTCCACGGTCACGCCCGACAGAGATGACTGGGCG
ACGATCAGGAAGCGGCAGACCGACTTCGAGGATGGCACCGAGCCGGCCGTCATTGTCGTCGGCGCTGGACAGGCC
GGACTGTCTATTGCCGCGCGGCTCAAGTCCCTCGGCGTCCGAGTCCTGATCATCGATCGAAACGAGCGCGTCGGC
GACAGCTGGCGCAAGCGGTACCGGCACCTCGTCCTCCACGACGTGGTCTGGTACGACCACATGCCGTACCTGAGC
TTCCCGCCCCAGTGGCCCGTCTTCGCGCCCAAAGACAAGCTCGCCAACTTCCTCGAGTCGTACGCCGATATCCTG
GAGCTCGACGTCTGGACGCAGGCCGAGCTGCAGAAGAGCGAGTGGGACGACAAGACTGGCGCCTGGACCGTCGTC
ATCTCGCGCAAGACCAAGGACGGCTCCAGCCAGACACGGACCTTTCACCCGCGCCACATCATCCAGGCCACCGGG
CACTCGGGCCTCAAGAAGCACCCGGCGTTCGCGGGCGCCGACGGCTTCAAGGGCGACAGGCTCTGCCACTCGTCC
GAGTTCCCCGGCGCGCCGGAGAAGGGCGGCAGCGGCAAGAAGGCCGTCGTCATCGGGAGCTGCAACTCGGCCCAC
GACATCGCCCAGGACTACCTGGAGAACGGGTACGAGGTGACGATGGTGCAGCGGTCCGGCACCTACGTCGTGTCG
ACGAGCAGCATCCTCGACATCGCCTTCAAGGGCCTCTACGACCAAGACGGCCCGCCGGTCGAAGACGCCGACCTG
CTGGCGGAGAGCCTCCCCGGCAGCGTCCTCAAGGCCGTCCACGCACAGGTCACCGCCCTGCAGCGGGAGAACGAC
AAAGAGACGCTGTCCGGCCTGGCCAAGGCGGGCTTCAAGGCGCACTCCGGACCCGACGGCGCCGGCATCTTCTTC
CAGTACCTGCAGTACGGGGGAGGCTACTACATCGACGTCGGGGGGTGCCGGCTCATCGCCGACGGCAAGATCAAG
GTCAAGCAGGGACAGGAAGTCGAGCAGATCTTGCCGCACGGGGTCCGGCTCGCCGACGGCTCCGAGCTCCCGGCC
GACGAGATCGTCCTCGCCACGGGATACCAGACCATGGAGTCCCAGACGAGGCATCTCTTCGGCGACAAGGTGGCC
GACCGGGTCCACGGCGTCTTCGGCTTCAACGACGAGGGCGAGATCCGCACCGTCTGGCAGCAGAGCGGACACCCC
GGCTTCTGGTATCACGGAGGTAACCTGGCCTTCTGTCGCTTCTACTCCAGGCTCCTGGCGCTGCAGATTAAAGGC
TTAGAGGAGGGCTTATATGGCTATGGTGAGATTTGA
Transcript >Hirsu2|615
ATGGCCACGGCGGCGATGGAAGTTCCGCCGCCCGCGGCCCAACGCTCTCACGAATGGGTCAACGTCCCGATCGCC
GAGATCCCCTCGTCGGCTCCGGCCGACTCGGCCGATGCTCGCGCCGGGGCGACGGGCGTGCTCGACGCCCTGAAC
CGGGCCCTTTCGCAGCGTGACTACGCAGCTGTCTCGCAGCTCTTCATCAAGGGCGGCTTCTGGCGCGACCACCTG
TGCTTGTCGTGGGAGTTCCGGGCGGCCCAGGGCCGGGACAAGATCCTCGACTTCCTCCAGAGCTGCGCCAGATCC
CGGGACGGGTTCCGGCTGAAGAAGCTGAGCCTCGACACCAGCATCGCCCCGTCTCGGCAGCCGCAGCTCGCGCCG
TTCGACGTCGAGGGCAAGTCCCGAGGGATTCAGGCCATCTTTCTGGTCGACACCACCATCGGTTCGGGCCAGGGC
GTCATGCGACTGGTTATGGACGGGGGCCAATGGCGCATCTTCACCCTCTATACGACTCTGTGCGAACTCAAGGGA
CACGGCGAGAATACCTTCCACCGCCGGCCACGGGGCGTTGATTCCACGGTCACGCCCGACAGAGATGACTGGGCG
ACGATCAGGAAGCGGCAGACCGACTTCGAGGATGGCACCGAGCCGGCCGTCATTGTCGTCGGCGCTGGACAGGCC
GGACTGTCTATTGCCGCGCGGCTCAAGTCCCTCGGCGTCCGAGTCCTGATCATCGATCGAAACGAGCGCGTCGGC
GACAGCTGGCGCAAGCGGTACCGGCACCTCGTCCTCCACGACGTGGTCTGGTACGACCACATGCCGTACCTGAGC
TTCCCGCCCCAGTGGCCCGTCTTCGCGCCCAAAGACAAGCTCGCCAACTTCCTCGAGTCGTACGCCGATATCCTG
GAGCTCGACGTCTGGACGCAGGCCGAGCTGCAGAAGAGCGAGTGGGACGACAAGACTGGCGCCTGGACCGTCGTC
ATCTCGCGCAAGACCAAGGACGGCTCCAGCCAGACACGGACCTTTCACCCGCGCCACATCATCCAGGCCACCGGG
CACTCGGGCCTCAAGAAGCACCCGGCGTTCGCGGGCGCCGACGGCTTCAAGGGCGACAGGCTCTGCCACTCGTCC
GAGTTCCCCGGCGCGCCGGAGAAGGGCGGCAGCGGCAAGAAGGCCGTCGTCATCGGGAGCTGCAACTCGGCCCAC
GACATCGCCCAGGACTACCTGGAGAACGGGTACGAGGTGACGATGGTGCAGCGGTCCGGCACCTACGTCGTGTCG
ACGAGCAGCATCCTCGACATCGCCTTCAAGGGCCTCTACGACCAAGACGGCCCGCCGGTCGAAGACGCCGACCTG
CTGGCGGAGAGCCTCCCCGGCAGCGTCCTCAAGGCCGTCCACGCACAGGTCACCGCCCTGCAGCGGGAGAACGAC
AAAGAGACGCTGTCCGGCCTGGCCAAGGCGGGCTTCAAGGCGCACTCCGGACCCGACGGCGCCGGCATCTTCTTC
CAGTACCTGCAGTACGGGGGAGGCTACTACATCGACGTCGGGGGGTGCCGGCTCATCGCCGACGGCAAGATCAAG
GTCAAGCAGGGACAGGAAGTCGAGCAGATCTTGCCGCACGGGGTCCGGCTCGCCGACGGCTCCGAGCTCCCGGCC
GACGAGATCGTCCTCGCCACGGGATACCAGACCATGGAGTCCCAGACGAGGCATCTCTTCGGCGACAAGGTGGCC
GACCGGGTCCACGGCGTCTTCGGCTTCAACGACGAGGGCGAGATCCGCACCGTCTGGCAGCAGAGCGGACACCCC
GGCTTCTGGTATCACGGAGGTAACCTGGCCTTCTGTCGCTTCTACTCCAGGCTCCTGGCGCTGCAGATTAAAGGC
TTAGAGGAGGGCTTATATGGCTATGGTGAGATTTGA
Gene >Hirsu2|615
ATGGCCACGGCGGCGATGGAAGTTCCGCCGCCCGCGGCCCAACGCTCTCACGAATGGGTCAACGTCCCGATCGCC
GAGATCCCCTCGTCGGCTCCGGCCGACTCGGCCGATGCTCGCGCCGGGGCGACGGGCGTGCTCGACGCCCTGAAC
CGGGCCCTTTCGCAGCGTGACTACGCAGCTGTCTCGCAGCTCTTCATCAAGGGCGGCTTCTGGCGCGACCACCTG
TGCTTGTCGTGGGAGTTCCGGGCGGCCCAGGGCCGGGACAAGATCCTCGACTTCCTCCAGAGCTGCGCCAGATCC
CGGGACGGGTTCCGGCTGAAGAAGCTGAGCCTCGACACCAGCATCGCCCCGTCTCGGCAGCCGCAGCTCGCGCCG
TTCGACGTCGAGGGCAAGTCCCGAGGGATTCAGGCCATCTTTCTGGTCGACACCACCATCGGTTCGGGCCAGGGC
GTCATGCGACTGGTTATGGACGGGGGCCAATGGCGCATCTTCACCCTCTATACGACTCTGTGCGAACTCAAGGGA
CACGGCGAGAATACCTTCCACCGCCGGCCACGGGGCGTTGATTCCACGGTCACGCCCGACAGAGATGACTGGGCG
ACGATCAGGAAGCGGCAGACCGACTTCGAGGATGGCACCGAGCCGGCCGTCATTGTCGTCGGTAGGACCGACGCC
TCCAGCCCCCCCTATCCTGCAGCCGCACGAGCGCATCGCTGATAGTTGACGCGGGCCCAGGCGCTGGACAGGCCG
GACTGTCTATTGCCGCGCGGCTCAAGTCCCTCGGCGTCCGAGTCCTGATCATCGATCGAAACGAGCGCGTCGGCG
ACAGCTGGCGCAAGCGGTACCGGCACCTCGTCCTCCACGACGTGGTCTGGTACGACCACATGCCGTACCTGAGCT
TCCCGCCCCAGTGGCCCGTCTTCGCGCCCAAAGACAAGCTCGCCAACTTCCTCGAGTCGTACGCCGATATCCTGG
AGCTCGACGTCTGGACGCAGGCCGAGCTGCAGAAGAGCGAGTGGGACGACAAGACTGGCGCCTGGACCGTCGTCA
TCTCGCGCAAGACCAAGGACGGCTCCAGCCAGACACGGACCTTTCACCCGCGCCACATCATCCAGGCCACCGGGC
ACTCGGGCCTCAAGAAGCACCCGGCGTTCGCGGGCGCCGACGGCTTCAAGGGCGACAGGCTCTGCCACTCGTCCG
AGTTCCCCGGCGCGCCGGAGAAGGGCGGCAGCGGCAAGAAGGCCGTCGTCATCGGGAGCTGCAACTCGGCCCACG
ACATCGCCCAGGACTACCTGGAGAACGGGTACGAGGTGACGATGGTGCAGCGGTCCGGCACCTACGTCGTGTCGA
CGAGCAGCATCCTCGACATCGCCTTCAAGGGCCTCTACGACCAAGACGGCCCGCCGGTCGAAGACGCCGACCTGC
TGGCGGAGAGCCTCCCCGGCAGCGTCCTCAAGGCCGTCCACGCACAGGTCACCGCCCTGCAGCGGGAGAACGACA
AAGAGACGCTGTCCGGCCTGGCCAAGGCGGGCTTCAAGGCGCACTCCGGACCCGACGGCGCCGGCATCTTCTTCC
AGTACCTGCAGTACGGGGGAGGCTACTACATCGACGTCGGGGGGTGCCGGCTCATCGCCGACGGCAAGATCAAGG
TCAAGCAGGGACAGGAAGTCGAGCAGATCTTGCCGCACGGGGTCCGGCTCGCCGACGGCTCCGAGCTCCCGGCCG
ACGAGATCGTCCTCGCCACGGGATACCAGACCATGGAGTCCCAGACGAGGCATCTCTTCGGCGACAAGGTGGCCG
ACCGGGTCCACGGCGTCTTCGGCTTCAACGACGAGGGCGAGATCCGCACCGTCTGGCAGCAGAGCGGACACCCCG
GCTTCTGGTATCACGGAGGTAACCTGGCCTTCTGTCGCTTCTACTCCAGGCTCCTGGCGCTGCAGATTAAAGGCT
TAGAGGAGGGCTTATATGGCTATGGTGAGATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail