Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6143
Gene name
LocationContig_311:21613..22334
Strand-
Gene length (bp)721
Transcript length (bp)531
Coding sequence length (bp)531
Protein length (aa) 177

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01592 NifU_N NifU-like N terminal domain 2.1E-55 32 156

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CRQ9|ISU1_KLULA Iron sulfur cluster assembly protein 1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ISU1 PE=3 SV=1 30 156 8.0E-68
sp|Q6FJY3|ISU1_CANGA Iron sulfur cluster assembly protein 1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ISU1 PE=3 SV=1 28 154 7.0E-66
sp|Q03020|ISU1_YEAST Iron sulfur cluster assembly protein 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISU1 PE=1 SV=1 29 154 9.0E-66
sp|Q6BGU0|ISU1_DEBHA Iron sulfur cluster assembly protein 1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ISU1 PE=3 SV=1 26 154 9.0E-65
sp|Q12056|ISU2_YEAST Iron sulfur cluster assembly protein 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISU2 PE=1 SV=1 28 156 2.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CRQ9|ISU1_KLULA Iron sulfur cluster assembly protein 1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ISU1 PE=3 SV=1 30 156 8.0E-68
sp|Q6FJY3|ISU1_CANGA Iron sulfur cluster assembly protein 1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ISU1 PE=3 SV=1 28 154 7.0E-66
sp|Q03020|ISU1_YEAST Iron sulfur cluster assembly protein 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISU1 PE=1 SV=1 29 154 9.0E-66
sp|Q6BGU0|ISU1_DEBHA Iron sulfur cluster assembly protein 1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ISU1 PE=3 SV=1 26 154 9.0E-65
sp|Q12056|ISU2_YEAST Iron sulfur cluster assembly protein 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISU2 PE=1 SV=1 28 156 2.0E-64
sp|O49627|ISU1_ARATH Iron-sulfur cluster assembly protein 1 OS=Arabidopsis thaliana GN=ISU1 PE=2 SV=1 30 165 5.0E-64
sp|Q9D7P6|ISCU_MOUSE Iron-sulfur cluster assembly enzyme ISCU, mitochondrial OS=Mus musculus GN=Iscu PE=1 SV=1 25 155 2.0E-63
sp|Q9H1K1|ISCU_HUMAN Iron-sulfur cluster assembly enzyme ISCU, mitochondrial OS=Homo sapiens GN=ISCU PE=1 SV=2 25 155 2.0E-63
sp|Q75C07|ISU1_ASHGO Iron sulfur cluster assembly protein 1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ISU1 PE=3 SV=1 28 154 9.0E-63
sp|Q9UTC6|ISU1_SCHPO Iron sulfur cluster assembly protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isu1 PE=1 SV=1 6 165 2.0E-62
sp|Q6CFQ0|ISU1_YARLI Iron sulfur cluster assembly protein 1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ISU1 PE=3 SV=1 28 154 1.0E-61
sp|Q57074|ISCU_HAEIN Iron-sulfur cluster assembly scaffold protein IscU OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=iscU PE=1 SV=2 32 155 2.0E-57
sp|Q9ZD61|ISCU_RICPR Iron-sulfur cluster assembly scaffold protein IscU OS=Rickettsia prowazekii (strain Madrid E) GN=iscU PE=3 SV=1 32 154 5.0E-57
sp|P0ACD7|ISCU_SHIFL Iron-sulfur cluster assembly scaffold protein IscU OS=Shigella flexneri GN=iscU PE=3 SV=1 32 154 3.0E-56
sp|P0ACD4|ISCU_ECOLI Iron-sulfur cluster assembly scaffold protein IscU OS=Escherichia coli (strain K12) GN=iscU PE=1 SV=1 32 154 3.0E-56
sp|P0ACD5|ISCU_ECOL6 Iron-sulfur cluster assembly scaffold protein IscU OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=iscU PE=3 SV=1 32 154 3.0E-56
sp|P0ACD6|ISCU_ECO57 Iron-sulfur cluster assembly scaffold protein IscU OS=Escherichia coli O157:H7 GN=iscU PE=1 SV=1 32 154 3.0E-56
sp|B0YLW7|ISU1_TRAHO Iron sulfur cluster assembly protein 1 OS=Trachipleistophora hominis GN=ISU1 PE=3 SV=1 29 155 4.0E-56
sp|O81433|ISU3_ARATH Iron-sulfur cluster assembly protein 3 OS=Arabidopsis thaliana GN=ISU3 PE=2 SV=1 30 158 5.0E-56
sp|O31270|ISCU_AZOVI Iron-sulfur cluster assembly scaffold protein IscU OS=Azotobacter vinelandii GN=iscU PE=1 SV=1 32 154 1.0E-55
sp|Q89A18|ISCU_BUCBP Iron-sulfur cluster assembly scaffold protein IscU OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=nifU PE=3 SV=1 32 155 8.0E-53
sp|O51885|ISCU_BUCAP Iron-sulfur cluster assembly scaffold protein IscU OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=iscU PE=3 SV=1 32 157 1.0E-52
sp|P57658|ISCU_BUCAI Iron-sulfur cluster assembly scaffold protein IscU OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=iscU PE=3 SV=1 32 154 2.0E-52
sp|Q8SSM2|ISU1_ENCCU Iron sulfur cluster assembly protein 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ISU1 PE=3 SV=1 32 159 2.0E-52
sp|Q9MAB6|ISU2_ARATH Iron-sulfur cluster assembly protein 2 OS=Arabidopsis thaliana GN=ISU2 PE=2 SV=1 28 157 2.0E-50
sp|P05340|NIFU_AZOVI Nitrogen fixation protein NifU OS=Azotobacter vinelandii GN=nifU PE=3 SV=2 32 154 1.0E-32
sp|P0DMG2|ISCU2_ARCFU Iron-sulfur cluster assembly scaffold protein IscU 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=iscU2 PE=1 SV=1 31 172 3.0E-31
sp|P0DMG1|ISCU1_ARCFU Iron-sulfur cluster assembly scaffold protein IscU 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=iscU1 PE=3 SV=1 31 172 3.0E-31
sp|Q43885|NIFU_TRIAZ Nitrogen fixation protein NifU OS=Trichormus azollae GN=nifU PE=3 SV=1 32 153 2.0E-30
sp|P20628|NIFU_NOSS1 Nitrogen fixation protein NifU OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nifU PE=3 SV=1 32 153 5.0E-30
sp|P23121|NIFU_AZOCH Nitrogen fixation protein NifU OS=Azotobacter chroococcum mcd 1 GN=nifU PE=3 SV=1 32 155 5.0E-30
sp|O67045|ISCU_AQUAE Iron-sulfur cluster assembly scaffold protein IscU OS=Aquifex aeolicus (strain VF5) GN=iscU PE=1 SV=1 32 158 1.0E-29
sp|P05343|NIFU_KLEPN Nitrogen fixation protein NifU OS=Klebsiella pneumoniae GN=nifU PE=3 SV=2 32 155 4.0E-29
sp|Q43909|NIFU_AZOBR Nitrogen fixation protein NifU OS=Azospirillum brasilense GN=nifU PE=3 SV=2 32 155 2.0E-23
sp|Q1AWB1|MNMA_RUBXD Bifunctional protein NifU/MnmA OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=nifU/mnmA PE=3 SV=1 32 155 5.0E-14
sp|O32163|SUFU_BACSU Zinc-dependent sulfurtransferase SufU OS=Bacillus subtilis (strain 168) GN=sufU PE=1 SV=1 31 155 3.0E-10
sp|Q01180|NIFU_RHOSH Nitrogen fixation protein NifU OS=Rhodobacter sphaeroides GN=nifU PE=3 SV=1 35 155 1.0E-08
sp|Q9A1G2|ISCU_STRP1 Iron-sulfur cluster assembly scaffold protein IscU OS=Streptococcus pyogenes serotype M1 GN=iscU PE=1 SV=1 29 148 2.0E-08
sp|Q9X192|ISCU_THEMA Iron-sulfur cluster assembly scaffold protein IscU OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=iscU PE=3 SV=1 29 148 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0016226 iron-sulfur cluster assembly Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0031163 metallo-sulfur cluster assembly No
GO:0051540 metal cluster binding No
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:0046872 metal ion binding No
GO:0006790 sulfur compound metabolic process No
GO:0005488 binding No
GO:0009987 cellular process No
GO:0048037 cofactor binding No
GO:0046914 transition metal ion binding No
GO:0022607 cellular component assembly No
GO:0071840 cellular component organization or biogenesis No
GO:0016043 cellular component organization No
GO:0043167 ion binding No
GO:0051186 cofactor metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6143
MLPLRAPFRSIRALPSPMAAAVAARVPARRFYHDKVIDHYSRPRNPGSMDKSDPSVGTGLVGAPACGDVMKLQIK
VDEKTGTITDAKFKTFGCGSAIASSSYLTTLVKGMRLEDASKIRNVDISKELCLPPVKLHCSMLAEDAIKAAIAD
YQGKNPKAPISDLAGTARTLEKEAAA*
Coding >Hirsu2|6143
ATGCTCCCGTTGCGCGCGCCCTTCCGCTCGATTCGGGCCCTGCCGTCGCCCATGGCCGCCGCCGTGGCCGCGCGC
GTGCCCGCCCGGCGCTTCTACCATGACAAAGTGATAGACCACTACAGCCGGCCGCGGAACCCGGGCTCGATGGAC
AAGTCGGACCCGTCGGTCGGCACCGGCCTCGTCGGCGCGCCCGCCTGCGGCGACGTCATGAAGCTGCAGATCAAG
GTCGACGAGAAGACGGGCACCATCACCGACGCCAAGTTCAAGACGTTTGGCTGCGGCTCCGCCATCGCCAGCTCC
AGCTACCTGACCACCCTGGTCAAGGGCATGCGACTGGAAGACGCCTCCAAGATCCGCAACGTCGACATCTCCAAG
GAGCTCTGCCTGCCGCCCGTCAAGCTCCACTGCTCCATGCTCGCCGAGGACGCCATCAAGGCCGCCATCGCCGAC
TACCAAGGGAAGAACCCCAAGGCCCCCATCTCCGACCTGGCCGGCACCGCCCGCACGCTGGAGAAGGAGGCGGCC
GCGTAG
Transcript >Hirsu2|6143
ATGCTCCCGTTGCGCGCGCCCTTCCGCTCGATTCGGGCCCTGCCGTCGCCCATGGCCGCCGCCGTGGCCGCGCGC
GTGCCCGCCCGGCGCTTCTACCATGACAAAGTGATAGACCACTACAGCCGGCCGCGGAACCCGGGCTCGATGGAC
AAGTCGGACCCGTCGGTCGGCACCGGCCTCGTCGGCGCGCCCGCCTGCGGCGACGTCATGAAGCTGCAGATCAAG
GTCGACGAGAAGACGGGCACCATCACCGACGCCAAGTTCAAGACGTTTGGCTGCGGCTCCGCCATCGCCAGCTCC
AGCTACCTGACCACCCTGGTCAAGGGCATGCGACTGGAAGACGCCTCCAAGATCCGCAACGTCGACATCTCCAAG
GAGCTCTGCCTGCCGCCCGTCAAGCTCCACTGCTCCATGCTCGCCGAGGACGCCATCAAGGCCGCCATCGCCGAC
TACCAAGGGAAGAACCCCAAGGCCCCCATCTCCGACCTGGCCGGCACCGCCCGCACGCTGGAGAAGGAGGCGGCC
GCGTAG
Gene >Hirsu2|6143
ATGCTCCCGTTGCGCGCGCCCTTCCGCTCGATTCGGGCCCTGCCGTCGCCCATGGCCGCCGCCGTGGCCGCGCGC
GTGCCCGCCCGGCGCTTCTACCATGACAAAGATAGGTCGCTGCCCCGGGACGGCGGGAGCGCGAGTGGCTGACGT
CGGCCGCACTGATAGACCACTACAGCCGGCCGCGGAACCCGGGCTCGATGGACAAGTCGGACCCGTCGGTCGGCA
CCGGCCTCGTCGGCGCGCCCGCCTGCGGCGACGTCATGAAGCTGCAGATCAAGGTCGACGAGAAGACGGGCACCA
TCACCGACGCCAAGTTCAAGACGTTTGGCTGCGGCTCCGCCATCGCCAGCTCCAGCTACCTGACCACCCTGGTCA
AGGGCATGCGACGTGAGTACCGGCCTTCCGACCGCGACGCCTGAGATGGGCTGAGAAATAACCGGTCCGTGTCCC
CTGCCGCAGTGGAAGACGCCTCCAAGATCCGCAACGTCGACATCTCCAAGGAGCTCTGCCTGCCGCCCGTCAAGC
GTACGTGCTGCCTCTGTCCCATCACCCCCATTCCGGAACAGGCACTGACGGCGCCCGCTCTCCAGTCCACTGCTC
CATGCTCGCCGAGGACGCCATCAAGGCCGCCATCGCCGACTACCAAGGGAAGAACCCCAAGGCCCCCATCTCCGA
CCTGGCCGGCACCGCCCGCACGCTGGAGAAGGAGGCGGCCGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail