© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|6143 |
| Gene name | |
| Location | Contig_311:21613..22334 |
| Strand | - |
| Gene length (bp) | 721 |
| Transcript length (bp) | 531 |
| Coding sequence length (bp) | 531 |
| Protein length (aa) | 177 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF01592 | NifU_N | NifU-like N terminal domain | 5.8E-55 | 32 | 156 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q6CRQ9|ISU1_KLULA | Iron sulfur cluster assembly protein 1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ISU1 PE=3 SV=1 | 30 | 156 | 8.0E-68 |
| sp|Q6FJY3|ISU1_CANGA | Iron sulfur cluster assembly protein 1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ISU1 PE=3 SV=1 | 28 | 154 | 7.0E-66 |
| sp|Q03020|ISU1_YEAST | Iron sulfur cluster assembly protein 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISU1 PE=1 SV=1 | 29 | 154 | 9.0E-66 |
| sp|Q6BGU0|ISU1_DEBHA | Iron sulfur cluster assembly protein 1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ISU1 PE=3 SV=1 | 26 | 154 | 9.0E-65 |
| sp|Q12056|ISU2_YEAST | Iron sulfur cluster assembly protein 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISU2 PE=1 SV=1 | 28 | 156 | 2.0E-64 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q6CRQ9|ISU1_KLULA | Iron sulfur cluster assembly protein 1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ISU1 PE=3 SV=1 | 30 | 156 | 8.0E-68 |
| sp|Q6FJY3|ISU1_CANGA | Iron sulfur cluster assembly protein 1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ISU1 PE=3 SV=1 | 28 | 154 | 7.0E-66 |
| sp|Q03020|ISU1_YEAST | Iron sulfur cluster assembly protein 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISU1 PE=1 SV=1 | 29 | 154 | 9.0E-66 |
| sp|Q6BGU0|ISU1_DEBHA | Iron sulfur cluster assembly protein 1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ISU1 PE=3 SV=1 | 26 | 154 | 9.0E-65 |
| sp|Q12056|ISU2_YEAST | Iron sulfur cluster assembly protein 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISU2 PE=1 SV=1 | 28 | 156 | 2.0E-64 |
| sp|O49627|ISU1_ARATH | Iron-sulfur cluster assembly protein 1 OS=Arabidopsis thaliana GN=ISU1 PE=2 SV=1 | 30 | 165 | 5.0E-64 |
| sp|Q9D7P6|ISCU_MOUSE | Iron-sulfur cluster assembly enzyme ISCU, mitochondrial OS=Mus musculus GN=Iscu PE=1 SV=1 | 25 | 155 | 2.0E-63 |
| sp|Q9H1K1|ISCU_HUMAN | Iron-sulfur cluster assembly enzyme ISCU, mitochondrial OS=Homo sapiens GN=ISCU PE=1 SV=2 | 25 | 155 | 2.0E-63 |
| sp|Q75C07|ISU1_ASHGO | Iron sulfur cluster assembly protein 1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ISU1 PE=3 SV=1 | 28 | 154 | 9.0E-63 |
| sp|Q9UTC6|ISU1_SCHPO | Iron sulfur cluster assembly protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isu1 PE=1 SV=1 | 6 | 165 | 2.0E-62 |
| sp|Q6CFQ0|ISU1_YARLI | Iron sulfur cluster assembly protein 1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ISU1 PE=3 SV=1 | 28 | 154 | 1.0E-61 |
| sp|Q57074|ISCU_HAEIN | Iron-sulfur cluster assembly scaffold protein IscU OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=iscU PE=1 SV=2 | 32 | 155 | 2.0E-57 |
| sp|Q9ZD61|ISCU_RICPR | Iron-sulfur cluster assembly scaffold protein IscU OS=Rickettsia prowazekii (strain Madrid E) GN=iscU PE=3 SV=1 | 32 | 154 | 5.0E-57 |
| sp|P0ACD7|ISCU_SHIFL | Iron-sulfur cluster assembly scaffold protein IscU OS=Shigella flexneri GN=iscU PE=3 SV=1 | 32 | 154 | 3.0E-56 |
| sp|P0ACD4|ISCU_ECOLI | Iron-sulfur cluster assembly scaffold protein IscU OS=Escherichia coli (strain K12) GN=iscU PE=1 SV=1 | 32 | 154 | 3.0E-56 |
| sp|P0ACD5|ISCU_ECOL6 | Iron-sulfur cluster assembly scaffold protein IscU OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=iscU PE=3 SV=1 | 32 | 154 | 3.0E-56 |
| sp|P0ACD6|ISCU_ECO57 | Iron-sulfur cluster assembly scaffold protein IscU OS=Escherichia coli O157:H7 GN=iscU PE=1 SV=1 | 32 | 154 | 3.0E-56 |
| sp|B0YLW7|ISU1_TRAHO | Iron sulfur cluster assembly protein 1 OS=Trachipleistophora hominis GN=ISU1 PE=3 SV=1 | 29 | 155 | 4.0E-56 |
| sp|O81433|ISU3_ARATH | Iron-sulfur cluster assembly protein 3 OS=Arabidopsis thaliana GN=ISU3 PE=2 SV=1 | 30 | 158 | 5.0E-56 |
| sp|O31270|ISCU_AZOVI | Iron-sulfur cluster assembly scaffold protein IscU OS=Azotobacter vinelandii GN=iscU PE=1 SV=1 | 32 | 154 | 1.0E-55 |
| sp|Q89A18|ISCU_BUCBP | Iron-sulfur cluster assembly scaffold protein IscU OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=nifU PE=3 SV=1 | 32 | 155 | 8.0E-53 |
| sp|O51885|ISCU_BUCAP | Iron-sulfur cluster assembly scaffold protein IscU OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=iscU PE=3 SV=1 | 32 | 157 | 1.0E-52 |
| sp|P57658|ISCU_BUCAI | Iron-sulfur cluster assembly scaffold protein IscU OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=iscU PE=3 SV=1 | 32 | 154 | 2.0E-52 |
| sp|Q8SSM2|ISU1_ENCCU | Iron sulfur cluster assembly protein 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ISU1 PE=3 SV=1 | 32 | 159 | 2.0E-52 |
| sp|Q9MAB6|ISU2_ARATH | Iron-sulfur cluster assembly protein 2 OS=Arabidopsis thaliana GN=ISU2 PE=2 SV=1 | 28 | 157 | 2.0E-50 |
| sp|P05340|NIFU_AZOVI | Nitrogen fixation protein NifU OS=Azotobacter vinelandii GN=nifU PE=3 SV=2 | 32 | 154 | 1.0E-32 |
| sp|P0DMG2|ISCU2_ARCFU | Iron-sulfur cluster assembly scaffold protein IscU 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=iscU2 PE=1 SV=1 | 31 | 172 | 3.0E-31 |
| sp|P0DMG1|ISCU1_ARCFU | Iron-sulfur cluster assembly scaffold protein IscU 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=iscU1 PE=3 SV=1 | 31 | 172 | 3.0E-31 |
| sp|Q43885|NIFU_TRIAZ | Nitrogen fixation protein NifU OS=Trichormus azollae GN=nifU PE=3 SV=1 | 32 | 153 | 2.0E-30 |
| sp|P20628|NIFU_NOSS1 | Nitrogen fixation protein NifU OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nifU PE=3 SV=1 | 32 | 153 | 5.0E-30 |
| sp|P23121|NIFU_AZOCH | Nitrogen fixation protein NifU OS=Azotobacter chroococcum mcd 1 GN=nifU PE=3 SV=1 | 32 | 155 | 5.0E-30 |
| sp|O67045|ISCU_AQUAE | Iron-sulfur cluster assembly scaffold protein IscU OS=Aquifex aeolicus (strain VF5) GN=iscU PE=1 SV=1 | 32 | 158 | 1.0E-29 |
| sp|P05343|NIFU_KLEPN | Nitrogen fixation protein NifU OS=Klebsiella pneumoniae GN=nifU PE=3 SV=2 | 32 | 155 | 4.0E-29 |
| sp|Q43909|NIFU_AZOBR | Nitrogen fixation protein NifU OS=Azospirillum brasilense GN=nifU PE=3 SV=2 | 32 | 155 | 2.0E-23 |
| sp|Q1AWB1|MNMA_RUBXD | Bifunctional protein NifU/MnmA OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=nifU/mnmA PE=3 SV=1 | 32 | 155 | 5.0E-14 |
| sp|O32163|SUFU_BACSU | Zinc-dependent sulfurtransferase SufU OS=Bacillus subtilis (strain 168) GN=sufU PE=1 SV=1 | 31 | 155 | 3.0E-10 |
| sp|Q01180|NIFU_RHOSH | Nitrogen fixation protein NifU OS=Rhodobacter sphaeroides GN=nifU PE=3 SV=1 | 35 | 155 | 1.0E-08 |
| sp|Q9A1G2|ISCU_STRP1 | Iron-sulfur cluster assembly scaffold protein IscU OS=Streptococcus pyogenes serotype M1 GN=iscU PE=1 SV=1 | 29 | 148 | 2.0E-08 |
| sp|Q9X192|ISCU_THEMA | Iron-sulfur cluster assembly scaffold protein IscU OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=iscU PE=3 SV=1 | 29 | 148 | 2.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0051536 | iron-sulfur cluster binding | Yes |
| GO:0016226 | iron-sulfur cluster assembly | Yes |
| GO:0005506 | iron ion binding | Yes |
| GO:0022607 | cellular component assembly | No |
| GO:0031163 | metallo-sulfur cluster assembly | No |
| GO:0008150 | biological_process | No |
| GO:0005488 | binding | No |
| GO:0016043 | cellular component organization | No |
| GO:0006790 | sulfur compound metabolic process | No |
| GO:0009987 | cellular process | No |
| GO:0008152 | metabolic process | No |
| GO:0043169 | cation binding | No |
| GO:0071840 | cellular component organization or biogenesis | No |
| GO:0043167 | ion binding | No |
| GO:0046872 | metal ion binding | No |
| GO:0003674 | molecular_function | No |
| GO:0046914 | transition metal ion binding | No |
| GO:0044237 | cellular metabolic process | No |
| GO:0051540 | metal cluster binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 14 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|6143 MLPLRAPFRSIRALPSPMAAAVAARVPARRFYHDKVIDHYSRPRNPGSMDKSDPSVGTGLVGAPACGDVMKLQIK VDEKTGTITDAKFKTFGCGSAIASSSYLTTLVKGMRLEDASKIRNVDISKELCLPPVKLHCSMLAEDAIKAAIAD YQGKNPKAPISDLAGTARTLEKEAAA* |
| Coding | >Hirsu2|6143 ATGCTCCCGTTGCGCGCGCCCTTCCGCTCGATTCGGGCCCTGCCGTCGCCCATGGCCGCCGCCGTGGCCGCGCGC GTGCCCGCCCGGCGCTTCTACCATGACAAAGTGATAGACCACTACAGCCGGCCGCGGAACCCGGGCTCGATGGAC AAGTCGGACCCGTCGGTCGGCACCGGCCTCGTCGGCGCGCCCGCCTGCGGCGACGTCATGAAGCTGCAGATCAAG GTCGACGAGAAGACGGGCACCATCACCGACGCCAAGTTCAAGACGTTTGGCTGCGGCTCCGCCATCGCCAGCTCC AGCTACCTGACCACCCTGGTCAAGGGCATGCGACTGGAAGACGCCTCCAAGATCCGCAACGTCGACATCTCCAAG GAGCTCTGCCTGCCGCCCGTCAAGCTCCACTGCTCCATGCTCGCCGAGGACGCCATCAAGGCCGCCATCGCCGAC TACCAAGGGAAGAACCCCAAGGCCCCCATCTCCGACCTGGCCGGCACCGCCCGCACGCTGGAGAAGGAGGCGGCC GCGTAG |
| Transcript | >Hirsu2|6143 ATGCTCCCGTTGCGCGCGCCCTTCCGCTCGATTCGGGCCCTGCCGTCGCCCATGGCCGCCGCCGTGGCCGCGCGC GTGCCCGCCCGGCGCTTCTACCATGACAAAGTGATAGACCACTACAGCCGGCCGCGGAACCCGGGCTCGATGGAC AAGTCGGACCCGTCGGTCGGCACCGGCCTCGTCGGCGCGCCCGCCTGCGGCGACGTCATGAAGCTGCAGATCAAG GTCGACGAGAAGACGGGCACCATCACCGACGCCAAGTTCAAGACGTTTGGCTGCGGCTCCGCCATCGCCAGCTCC AGCTACCTGACCACCCTGGTCAAGGGCATGCGACTGGAAGACGCCTCCAAGATCCGCAACGTCGACATCTCCAAG GAGCTCTGCCTGCCGCCCGTCAAGCTCCACTGCTCCATGCTCGCCGAGGACGCCATCAAGGCCGCCATCGCCGAC TACCAAGGGAAGAACCCCAAGGCCCCCATCTCCGACCTGGCCGGCACCGCCCGCACGCTGGAGAAGGAGGCGGCC GCGTAG |
| Gene | >Hirsu2|6143 ATGCTCCCGTTGCGCGCGCCCTTCCGCTCGATTCGGGCCCTGCCGTCGCCCATGGCCGCCGCCGTGGCCGCGCGC GTGCCCGCCCGGCGCTTCTACCATGACAAAGATAGGTCGCTGCCCCGGGACGGCGGGAGCGCGAGTGGCTGACGT CGGCCGCACTGATAGACCACTACAGCCGGCCGCGGAACCCGGGCTCGATGGACAAGTCGGACCCGTCGGTCGGCA CCGGCCTCGTCGGCGCGCCCGCCTGCGGCGACGTCATGAAGCTGCAGATCAAGGTCGACGAGAAGACGGGCACCA TCACCGACGCCAAGTTCAAGACGTTTGGCTGCGGCTCCGCCATCGCCAGCTCCAGCTACCTGACCACCCTGGTCA AGGGCATGCGACGTGAGTACCGGCCTTCCGACCGCGACGCCTGAGATGGGCTGAGAAATAACCGGTCCGTGTCCC CTGCCGCAGTGGAAGACGCCTCCAAGATCCGCAACGTCGACATCTCCAAGGAGCTCTGCCTGCCGCCCGTCAAGC GTACGTGCTGCCTCTGTCCCATCACCCCCATTCCGGAACAGGCACTGACGGCGCCCGCTCTCCAGTCCACTGCTC CATGCTCGCCGAGGACGCCATCAAGGCCGCCATCGCCGACTACCAAGGGAAGAACCCCAAGGCCCCCATCTCCGA CCTGGCCGGCACCGCCCGCACGCTGGAGAAGGAGGCGGCCGCGTAG |