Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6138
Gene name
LocationContig_311:2992..6765
Strand+
Gene length (bp)3773
Transcript length (bp)3714
Coding sequence length (bp)3714
Protein length (aa) 1238

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00562 RNA_pol_Rpb2_6 RNA polymerase Rpb2, domain 6 4.0E-112 700 1077
PF04563 RNA_pol_Rpb2_1 RNA polymerase beta subunit 1.2E-32 39 435
PF04565 RNA_pol_Rpb2_3 RNA polymerase Rpb2, domain 3 3.2E-28 490 554
PF06883 RNA_pol_Rpa2_4 RNA polymerase I, Rpa2 specific domain 7.9E-25 594 651
PF04561 RNA_pol_Rpb2_2 RNA polymerase Rpb2, domain 2 9.9E-24 203 400
PF04560 RNA_pol_Rpb2_7 RNA polymerase Rpb2, domain 7 3.7E-14 1079 1151

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74633|RPA2_NEUCR DNA-directed RNA polymerase I subunit RPA2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acr-2 PE=1 SV=2 3 1220 0.0E+00
sp|Q75DS1|RPA2_ASHGO DNA-directed RNA polymerase I subunit RPA2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPA2 PE=3 SV=2 13 1209 0.0E+00
sp|P22138|RPA2_YEAST DNA-directed RNA polymerase I subunit RPA135 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA135 PE=1 SV=1 2 1209 0.0E+00
sp|Q9P7X8|RPA2_SCHPO Probable DNA-directed RNA polymerase I subunit RPA2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa2 PE=3 SV=2 14 1209 0.0E+00
sp|Q54BM1|RPA2_DICDI DNA-directed RNA polymerase I subunit rpa2 OS=Dictyostelium discoideum GN=polr1b PE=3 SV=1 36 1210 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74633|RPA2_NEUCR DNA-directed RNA polymerase I subunit RPA2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acr-2 PE=1 SV=2 3 1220 0.0E+00
sp|Q75DS1|RPA2_ASHGO DNA-directed RNA polymerase I subunit RPA2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPA2 PE=3 SV=2 13 1209 0.0E+00
sp|P22138|RPA2_YEAST DNA-directed RNA polymerase I subunit RPA135 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA135 PE=1 SV=1 2 1209 0.0E+00
sp|Q9P7X8|RPA2_SCHPO Probable DNA-directed RNA polymerase I subunit RPA2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa2 PE=3 SV=2 14 1209 0.0E+00
sp|Q54BM1|RPA2_DICDI DNA-directed RNA polymerase I subunit rpa2 OS=Dictyostelium discoideum GN=polr1b PE=3 SV=1 36 1210 0.0E+00
sp|Q9H9Y6|RPA2_HUMAN DNA-directed RNA polymerase I subunit RPA2 OS=Homo sapiens GN=POLR1B PE=1 SV=2 35 1209 0.0E+00
sp|Q5REE8|RPA2_PONAB DNA-directed RNA polymerase I subunit RPA2 OS=Pongo abelii GN=POLR1B PE=2 SV=1 35 1209 0.0E+00
sp|P70700|RPA2_MOUSE DNA-directed RNA polymerase I subunit RPA2 OS=Mus musculus GN=Polr1b PE=1 SV=2 6 1209 0.0E+00
sp|P20028|RPA2_DROME DNA-directed RNA polymerase I subunit RPA2 OS=Drosophila melanogaster GN=RpI135 PE=2 SV=2 42 1210 0.0E+00
sp|P28365|RPA2_EUPOC DNA-directed RNA polymerase I subunit RPA2 OS=Euplotes octocarinatus GN=RPA2 PE=3 SV=2 113 1210 0.0E+00
sp|F4I366|NRPA2_ARATH DNA-directed RNA polymerase I subunit 2 OS=Arabidopsis thaliana GN=NRPA2 PE=2 SV=1 33 1210 0.0E+00
sp|O54888|RPA2_RAT DNA-directed RNA polymerase I subunit RPA2 OS=Rattus norvegicus GN=Polr1b PE=1 SV=1 693 1209 4.0E-151
sp|Q9NW08|RPC2_HUMAN DNA-directed RNA polymerase III subunit RPC2 OS=Homo sapiens GN=POLR3B PE=1 SV=2 111 1120 9.0E-131
sp|P59470|RPC2_MOUSE DNA-directed RNA polymerase III subunit RPC2 OS=Mus musculus GN=Polr3b PE=1 SV=2 111 1120 3.0E-130
sp|O54888|RPA2_RAT DNA-directed RNA polymerase I subunit RPA2 OS=Rattus norvegicus GN=Polr1b PE=1 SV=1 6 614 3.0E-126
sp|P25167|RPC2_DROME DNA-directed RNA polymerase III subunit RPC2 OS=Drosophila melanogaster GN=RpIII128 PE=2 SV=2 32 1120 4.0E-118
sp|Q10233|RPC2_SCHPO DNA-directed RNA polymerase III subunit RPC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc2 PE=2 SV=1 104 1120 6.0E-118
sp|P22276|RPC2_YEAST DNA-directed RNA polymerase III subunit RPC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RET1 PE=1 SV=2 32 1120 3.0E-116
sp|F4KD38|NRPC2_ARATH DNA-directed RNA polymerase III subunit 2 OS=Arabidopsis thaliana GN=NRPC2 PE=2 SV=1 40 1120 2.0E-114
sp|P38420|NRPB2_ARATH DNA-directed RNA polymerase II subunit 2 OS=Arabidopsis thaliana GN=NRPB2 PE=1 SV=2 113 1218 1.0E-113
sp|P11513|RPOB_SULAC DNA-directed RNA polymerase subunit B OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpoB PE=3 SV=2 40 1120 4.0E-113
sp|P31814|RPOB_THECE DNA-directed RNA polymerase subunit B OS=Thermococcus celer GN=rpoB PE=3 SV=1 31 1120 6.0E-113
sp|Q54J75|RPB2_DICDI DNA-directed RNA polymerase II subunit rpb2 OS=Dictyostelium discoideum GN=polr2b PE=3 SV=1 102 1146 1.0E-112
sp|Q42877|RPB2_SOLLC DNA-directed RNA polymerase II subunit RPB2 OS=Solanum lycopersicum GN=RPB2 PE=2 SV=1 113 1153 9.0E-112
sp|P08266|RPB2_DROME DNA-directed RNA polymerase II subunit RPB2 OS=Drosophila melanogaster GN=RpII140 PE=2 SV=2 113 1120 2.0E-111
sp|P30876|RPB2_HUMAN DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens GN=POLR2B PE=1 SV=1 113 1148 3.0E-110
sp|Q8CFI7|RPB2_MOUSE DNA-directed RNA polymerase II subunit RPB2 OS=Mus musculus GN=Polr2b PE=1 SV=2 113 1148 3.0E-110
sp|Q10578|RPB2_CAEEL DNA-directed RNA polymerase II subunit RPB2 OS=Caenorhabditis elegans GN=rpb-2 PE=2 SV=2 113 1120 2.0E-109
sp|Q6FLD5|RPB2_CANGA DNA-directed RNA polymerase II subunit RPB2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPB2 PE=3 SV=1 149 1153 6.0E-100
sp|Q8SR75|RPB2_ENCCU DNA-directed RNA polymerase II subunit RPB2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPB2 PE=3 SV=1 92 1148 4.0E-99
sp|Q03587|RPOB_THEAC DNA-directed RNA polymerase subunit B OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpoB PE=3 SV=1 112 1116 8.0E-99
sp|O27124|RPOB1_METTH DNA-directed RNA polymerase subunit B' OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpoB1 PE=3 SV=1 587 1120 1.0E-94
sp|P08518|RPB2_YEAST DNA-directed RNA polymerase II subunit RPB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB2 PE=1 SV=2 113 1153 2.0E-93
sp|P09845|RPOB1_METTW DNA-directed RNA polymerase subunit B' OS=Methanothermobacter thermautotrophicus (strain Winter) GN=rpoB1 PE=3 SV=2 587 1120 3.0E-93
sp|Q60181|RPOB1_METJA DNA-directed RNA polymerase subunit B' OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoB1 PE=3 SV=1 662 1122 5.0E-93
sp|O28392|RPOB1_ARCFU DNA-directed RNA polymerase subunit B' OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpoB1 PE=4 SV=1 662 1120 1.0E-91
sp|P41557|RPOB1_METVS DNA-directed RNA polymerase subunit B' OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpoB1 PE=3 SV=2 662 1122 1.0E-88
sp|Q54IZ9|RPC2_DICDI DNA-directed RNA polymerase III subunit rpc2 OS=Dictyostelium discoideum GN=polr3b PE=3 SV=1 686 1120 2.0E-86
sp|P0CX03|RPOB1_HALSA DNA-directed RNA polymerase subunit B' OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpoB1 PE=3 SV=1 660 1120 8.0E-86
sp|B0R8D5|RPOB1_HALS3 DNA-directed RNA polymerase subunit B' OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpoB1 PE=1 SV=1 660 1120 8.0E-86
sp|Q7T6X7|RPO2_MIMIV DNA-directed RNA polymerase subunit 2 OS=Acanthamoeba polyphaga mimivirus GN=RPO2 PE=1 SV=2 37 1211 2.0E-85
sp|Q753Q4|RPB2_ASHGO DNA-directed RNA polymerase II subunit RPB2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPB2 PE=3 SV=1 670 1153 3.0E-84
sp|Q9LV32|RPD2B_ARATH DNA-directed RNA polymerase D subunit 2b OS=Arabidopsis thaliana GN=NRPD2b PE=2 SV=1 149 1207 4.0E-83
sp|Q02061|RPB2_SCHPO DNA-directed RNA polymerase II subunit RPB2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb2 PE=1 SV=2 687 1151 8.0E-83
sp|A5DHT2|RPB2_PICGU DNA-directed RNA polymerase II subunit RPB2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPB2 PE=3 SV=3 688 1148 6.0E-82
sp|Q91F97|RPB2_IIV6 Probable DNA-directed RNA polymerase II subunit RPB2 homolog OS=Invertebrate iridescent virus 6 GN=IIV6-428L PE=3 SV=1 58 1209 1.0E-80
sp|Q9LK40|NRPD2_ARATH DNA-directed RNA polymerases IV and V subunit 2 OS=Arabidopsis thaliana GN=NRPD2 PE=1 SV=1 112 1207 1.0E-80
sp|P0C8K2|RPB2_ASFK5 DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-065 PE=3 SV=1 43 1153 2.0E-79
sp|P0C8K5|RPB2_ASFWA DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-063 PE=3 SV=1 43 1153 2.0E-78
sp|P0C8K4|RPB2_ASFP4 DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-065 PE=3 SV=1 43 1153 2.0E-78
sp|P0C8K3|RPB2_ASFM2 DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-061 PE=3 SV=1 43 1153 3.0E-78
sp|P42487|RPB2_ASFB7 DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-053 PE=3 SV=1 43 1153 2.0E-77
sp|Q197F1|RPB2_IIV3 Probable DNA-directed RNA polymerase II subunit RPB2 homolog OS=Invertebrate iridescent virus 3 GN=IIV3-009R PE=3 SV=1 354 1160 1.0E-76
sp|Q6GZR3|RPB2_FRG3G Putative DNA-directed RNA polymerase II subunit RPB2 homolog OS=Frog virus 3 (isolate Goorha) GN=FV3-062L PE=3 SV=1 888 1120 3.0E-38
sp|Q6F0L7|RPOB_MESFL DNA-directed RNA polymerase subunit beta OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpoB PE=3 SV=1 520 1109 2.0E-37
sp|Q8V4V3|RP132_MONPV DNA-directed RNA polymerase 132 kDa polypeptide OS=Monkeypox virus GN=RPO132 PE=3 SV=1 710 1153 5.0E-37
sp|P17474|RP132_CWPXB DNA-directed RNA polymerase 132 kDa polypeptide OS=Cowpox virus (strain Brighton Red) GN=RPO132 PE=3 SV=1 710 1145 6.0E-37
sp|Q76ZP7|RP132_VACCW DNA-directed RNA polymerase 133 kDa polypeptide OS=Vaccinia virus (strain Western Reserve) GN=RPO132 PE=1 SV=1 710 1145 6.0E-37
sp|P68694|RP132_VACCC DNA-directed RNA polymerase 133 kDa polypeptide OS=Vaccinia virus (strain Copenhagen) GN=RPO132 PE=3 SV=1 710 1145 6.0E-37
sp|Q6RZF8|RP132_RABPU DNA-directed RNA polymerase 132 kDa polypeptide OS=Rabbitpox virus (strain Utrecht) GN=RPO132 PE=3 SV=1 710 1145 7.0E-37
sp|O57230|RP132_VACCA DNA-directed RNA polymerase 133 kDa polypeptide OS=Vaccinia virus (strain Ankara) GN=RPO132 PE=3 SV=1 710 1145 8.0E-37
sp|Q80DV1|RP132_CWPXG DNA-directed RNA polymerase 132 kDa polypeptide OS=Cowpox virus (strain GRI-90 / Grishak) GN=RPO132 PE=3 SV=1 710 1153 8.0E-37
sp|Q8DL55|RPOB_THEEB DNA-directed RNA polymerase subunit beta OS=Thermosynechococcus elongatus (strain BP-1) GN=rpoB PE=3 SV=1 492 1109 9.0E-37
sp|Q9JF79|RP132_VACCT DNA-directed RNA polymerase 133 kDa polypeptide OS=Vaccinia virus (strain Tian Tan) GN=RPO132 PE=3 SV=1 710 1145 9.0E-37
sp|Q775Q3|RP132_CAMPS DNA-directed RNA polymerase 132 kDa polypeptide OS=Camelpox virus (strain CMS) GN=RPO132 PE=3 SV=1 710 1153 1.0E-36
sp|Q8V2N1|RP132_CAMPM DNA-directed RNA polymerase 132 kDa polypeptide OS=Camelpox virus (strain M-96) GN=RPO132 PE=3 SV=1 710 1153 1.0E-36
sp|Q8JL90|RP132_ECTVM DNA-directed RNA polymerase 132 kDa polypeptide OS=Ectromelia virus (strain Moscow) GN=RPO132 PE=3 SV=1 710 1145 1.0E-36
sp|Q04E85|RPOB_OENOB DNA-directed RNA polymerase subunit beta OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpoB PE=3 SV=1 768 1194 3.0E-36
sp|P33811|RP132_VAR67 DNA-directed RNA polymerase 133 kDa polypeptide OS=Variola virus (isolate Human/India/Ind3/1967) GN=RPO132 PE=3 SV=3 710 1153 4.0E-36
sp|B1VAM6|RPOB_PHYAS DNA-directed RNA polymerase subunit beta OS=Phytoplasma australiense GN=rpoB PE=3 SV=1 674 1109 1.0E-35
sp|B5RRJ7|RPOB_BORRA DNA-directed RNA polymerase subunit beta OS=Borrelia recurrentis (strain A1) GN=rpoB PE=3 SV=1 768 1109 1.0E-35
sp|B5RLU9|RPOB_BORDL DNA-directed RNA polymerase subunit beta OS=Borrelia duttonii (strain Ly) GN=rpoB PE=3 SV=1 768 1109 1.0E-35
sp|Q18CF1|RPOB_PEPD6 DNA-directed RNA polymerase subunit beta OS=Peptoclostridium difficile (strain 630) GN=rpoB PE=3 SV=1 768 1109 3.0E-35
sp|A1QZH7|RPOB_BORT9 DNA-directed RNA polymerase subunit beta OS=Borrelia turicatae (strain 91E135) GN=rpoB PE=3 SV=1 768 1109 4.0E-35
sp|Q5HID3|RPOB_STAAC DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain COL) GN=rpoB PE=3 SV=1 768 1111 4.0E-35
sp|A5IQ96|RPOB_STAA9 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain JH9) GN=rpoB PE=3 SV=1 768 1111 4.0E-35
sp|Q6GJC6|RPOB_STAAR DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain MRSA252) GN=rpoB PE=3 SV=1 768 1111 4.0E-35
sp|P60279|RPOB_STAAW DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain MW2) GN=rpoB PE=3 SV=1 768 1111 4.0E-35
sp|A8YZP0|RPOB_STAAT DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rpoB PE=3 SV=1 768 1111 4.0E-35
sp|Q6GBU5|RPOB_STAAS DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain MSSA476) GN=rpoB PE=3 SV=1 768 1111 4.0E-35
sp|P60278|RPOB_STAAN DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain N315) GN=rpoB PE=1 SV=1 768 1111 4.0E-35
sp|A6QEJ4|RPOB_STAAE DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain Newman) GN=rpoB PE=3 SV=1 768 1111 4.0E-35
sp|Q2YSB9|RPOB_STAAB DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpoB PE=3 SV=1 768 1111 4.0E-35
sp|P47768|RPOB_STAA8 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain NCTC 8325) GN=rpoB PE=3 SV=2 768 1111 4.0E-35
sp|Q2FJ98|RPOB_STAA3 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain USA300) GN=rpoB PE=3 SV=2 768 1111 4.0E-35
sp|A6TZ19|RPOB_STAA2 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain JH1) GN=rpoB PE=3 SV=1 768 1111 4.0E-35
sp|A7WYW7|RPOB_STAA1 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpoB PE=3 SV=1 768 1111 4.0E-35
sp|Q932F8|RPOB_STAAM DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpoB PE=3 SV=1 768 1111 4.0E-35
sp|Q8CQ84|RPOB_STAES DNA-directed RNA polymerase subunit beta OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpoB PE=3 SV=1 768 1111 7.0E-35
sp|Q5HRL0|RPOB_STAEQ DNA-directed RNA polymerase subunit beta OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpoB PE=3 SV=1 768 1111 7.0E-35
sp|Q49V52|RPOB_STAS1 DNA-directed RNA polymerase subunit beta OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpoB PE=3 SV=1 768 1145 8.0E-35
sp|B2S092|RPOB_BORHD DNA-directed RNA polymerase subunit beta OS=Borrelia hermsii (strain HS1 / DAH) GN=rpoB PE=3 SV=1 768 1109 8.0E-35
sp|B9E8Q5|RPOB_MACCJ DNA-directed RNA polymerase subunit beta OS=Macrococcus caseolyticus (strain JCSC5402) GN=rpoB PE=3 SV=1 768 1111 8.0E-35
sp|Q2RFN9|RPOB_MOOTA DNA-directed RNA polymerase subunit beta OS=Moorella thermoacetica (strain ATCC 39073) GN=rpoB PE=3 SV=1 673 1109 1.0E-34
sp|Q661M9|RPOB_BORBP DNA-directed RNA polymerase subunit beta OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpoB PE=3 SV=1 775 1171 1.0E-34
sp|P16716|RP132_SHEVK DNA-directed RNA polymerase 132 kDa polypeptide (Fragment) OS=Sheeppox virus (strain KS-1) GN=RPO132 PE=3 SV=1 710 1120 1.0E-34
sp|Q4L3K3|RPOB_STAHJ DNA-directed RNA polymerase subunit beta OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpoB PE=3 SV=1 768 1111 1.0E-34
sp|Q9J544|RP132_FOWPN DNA-directed RNA polymerase 132 kDa polypeptide OS=Fowlpox virus (strain NVSL) GN=RPO132 PE=3 SV=1 710 1145 1.0E-34
sp|B9DKV0|RPOB_STACT DNA-directed RNA polymerase subunit beta OS=Staphylococcus carnosus (strain TM300) GN=rpoB PE=3 SV=1 768 1111 5.0E-34
sp|Q85FR7|RPOB_CYAME DNA-directed RNA polymerase subunit beta OS=Cyanidioschyzon merolae GN=rpoB PE=3 SV=1 768 1109 6.0E-34
sp|Q85FM7|RPOB_ADICA DNA-directed RNA polymerase subunit beta OS=Adiantum capillus-veneris GN=rpoB PE=2 SV=2 768 1113 1.0E-33
sp|Q6YQW3|RPOB_ONYPE DNA-directed RNA polymerase subunit beta OS=Onion yellows phytoplasma (strain OY-M) GN=rpoB PE=3 SV=1 768 1109 1.0E-33
sp|Q88XZ3|RPOB_LACPL DNA-directed RNA polymerase subunit beta OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpoB PE=3 SV=2 768 1109 1.0E-33
sp|Q0SNB8|RPOB_BORAP DNA-directed RNA polymerase subunit beta OS=Borrelia afzelii (strain PKo) GN=rpoB PE=3 SV=1 775 1167 1.0E-33
sp|P47767|RPOB_SPICI DNA-directed RNA polymerase subunit beta OS=Spiroplasma citri GN=rpoB PE=3 SV=1 768 1109 1.0E-33
sp|Q59191|RPOB_BORBU DNA-directed RNA polymerase subunit beta OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpoB PE=3 SV=2 775 1167 2.0E-33
sp|Q2NJ15|RPOB_AYWBP DNA-directed RNA polymerase subunit beta OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpoB PE=3 SV=1 768 1109 2.0E-33
sp|B7J1W1|RPOB_BORBZ DNA-directed RNA polymerase subunit beta OS=Borrelia burgdorferi (strain ZS7) GN=rpoB PE=3 SV=1 775 1167 2.0E-33
sp|A9NEL7|RPOB_ACHLI DNA-directed RNA polymerase subunit beta OS=Acholeplasma laidlawii (strain PG-8A) GN=rpoB PE=3 SV=1 768 1109 2.0E-33
sp|Q98Q23|RPOB_MYCPU DNA-directed RNA polymerase subunit beta OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpoB PE=3 SV=1 520 1109 4.0E-33
sp|Q5WLS0|RPOB_BACSK DNA-directed RNA polymerase subunit beta OS=Bacillus clausii (strain KSM-K16) GN=rpoB PE=3 SV=1 768 1109 4.0E-33
sp|C0ZIH0|RPOB_BREBN DNA-directed RNA polymerase subunit beta OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rpoB PE=3 SV=1 768 1109 5.0E-33
sp|Q04C22|RPOB_LACDB DNA-directed RNA polymerase subunit beta OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpoB PE=3 SV=2 768 1109 5.0E-33
sp|Q03V60|RPOB_LEUMM DNA-directed RNA polymerase subunit beta OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpoB PE=3 SV=1 768 1109 5.0E-33
sp|B3QZH0|RPOB_PHYMT DNA-directed RNA polymerase subunit beta OS=Phytoplasma mali (strain AT) GN=rpoB PE=3 SV=1 768 1109 5.0E-33
sp|A5VLL4|RPOB_LACRD DNA-directed RNA polymerase subunit beta OS=Lactobacillus reuteri (strain DSM 20016) GN=rpoB PE=3 SV=1 768 1165 6.0E-33
sp|B1MVW8|RPOB_LEUCK DNA-directed RNA polymerase subunit beta OS=Leuconostoc citreum (strain KM20) GN=rpoB PE=3 SV=1 768 1109 6.0E-33
sp|B9MQG5|RPOB_CALBD DNA-directed RNA polymerase subunit beta OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpoB PE=3 SV=1 768 1109 6.0E-33
sp|Q03PU9|RPOB_LACBA DNA-directed RNA polymerase subunit beta OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpoB PE=3 SV=1 768 1169 6.0E-33
sp|Q1GBM5|RPOB_LACDA DNA-directed RNA polymerase subunit beta OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpoB PE=3 SV=1 768 1109 7.0E-33
sp|A8MLD2|RPOB_ALKOO DNA-directed RNA polymerase subunit beta OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpoB PE=3 SV=1 768 1109 8.0E-33
sp|Q8RHI6|RPOB_FUSNN DNA-directed RNA polymerase subunit beta OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpoB PE=3 SV=1 768 1109 8.0E-33
sp|C4KZQ4|RPOB_EXISA DNA-directed RNA polymerase subunit beta OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rpoB PE=3 SV=1 768 1145 8.0E-33
sp|Q32RW5|RPOB_STAPU DNA-directed RNA polymerase subunit beta OS=Staurastrum punctulatum GN=rpoB PE=3 SV=1 768 1112 9.0E-33
sp|A8YXJ8|RPOB_LACH4 DNA-directed RNA polymerase subunit beta OS=Lactobacillus helveticus (strain DPC 4571) GN=rpoB PE=3 SV=1 520 1109 1.0E-32
sp|Q4A5S7|RPOB_MYCS5 DNA-directed RNA polymerase subunit beta OS=Mycoplasma synoviae (strain 53) GN=rpoB PE=3 SV=2 699 1117 1.0E-32
sp|Q9MUS5|RPOB_MESVI DNA-directed RNA polymerase subunit beta OS=Mesostigma viride GN=rpoB PE=3 SV=1 768 1109 1.0E-32
sp|B1HMZ6|RPOB_LYSSC DNA-directed RNA polymerase subunit beta OS=Lysinibacillus sphaericus (strain C3-41) GN=rpoB PE=3 SV=1 768 1109 1.0E-32
sp|P22703|RPOB_NOSS1 DNA-directed RNA polymerase subunit beta OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rpoB PE=3 SV=2 768 1109 2.0E-32
sp|A4XI30|RPOB_CALS8 DNA-directed RNA polymerase subunit beta OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpoB PE=3 SV=1 768 1109 2.0E-32
sp|A4QLI6|RPOB_LOBMA DNA-directed RNA polymerase subunit beta OS=Lobularia maritima GN=rpoB PE=3 SV=1 768 1113 3.0E-32
sp|A4QK10|RPOB_ARAHI DNA-directed RNA polymerase subunit beta OS=Arabis hirsuta GN=rpoB PE=3 SV=1 768 1113 3.0E-32
sp|Q85X54|RPOB_PINKO DNA-directed RNA polymerase subunit beta OS=Pinus koraiensis GN=rpoB PE=3 SV=1 768 1113 3.0E-32
sp|A4QLS5|RPOB_NASOF DNA-directed RNA polymerase subunit beta OS=Nasturtium officinale GN=rpoB PE=3 SV=1 768 1113 3.0E-32
sp|A3DIZ4|RPOB_CLOTH DNA-directed RNA polymerase subunit beta OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpoB PE=3 SV=1 768 1109 3.0E-32
sp|B8G4U9|RPOB_CHLAD DNA-directed RNA polymerase subunit beta OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpoB PE=3 SV=1 768 1109 3.0E-32
sp|A8AZI3|RPOB_STRGC DNA-directed RNA polymerase subunit beta OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpoB PE=3 SV=1 768 1109 3.0E-32
sp|Q5M2F5|RPOB_STRT2 DNA-directed RNA polymerase subunit beta OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpoB PE=3 SV=1 768 1109 3.0E-32
sp|Q5LXV3|RPOB_STRT1 DNA-directed RNA polymerase subunit beta OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpoB PE=3 SV=1 768 1109 3.0E-32
sp|Q03IK2|RPOB_STRTD DNA-directed RNA polymerase subunit beta OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpoB PE=3 SV=1 768 1109 3.0E-32
sp|B9LL91|RPOB_CHLSY DNA-directed RNA polymerase subunit beta OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpoB PE=3 SV=1 768 1109 4.0E-32
sp|A9WH12|RPOB_CHLAA DNA-directed RNA polymerase subunit beta OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpoB PE=3 SV=1 768 1109 4.0E-32
sp|Q03EA9|RPOB_PEDPA DNA-directed RNA polymerase subunit beta OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpoB PE=3 SV=1 768 1109 4.0E-32
sp|Q046D2|RPOB_LACGA DNA-directed RNA polymerase subunit beta OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpoB PE=3 SV=1 768 1109 4.0E-32
sp|O78485|RPOB_GUITH DNA-directed RNA polymerase subunit beta OS=Guillardia theta GN=rpoB PE=3 SV=1 768 1109 4.0E-32
sp|B2TIG8|RPOB_CLOBB DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rpoB PE=3 SV=1 768 1109 4.0E-32
sp|Q74L95|RPOB_LACJO DNA-directed RNA polymerase subunit beta OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpoB PE=3 SV=1 768 1109 4.0E-32
sp|Q1WVA5|RPOB_LACS1 DNA-directed RNA polymerase subunit beta OS=Lactobacillus salivarius (strain UCC118) GN=rpoB PE=3 SV=1 768 1109 5.0E-32
sp|B2UYA3|RPOB_CLOBA DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rpoB PE=3 SV=1 768 1109 5.0E-32
sp|B1I8R4|RPOB_STRPI DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpoB PE=3 SV=1 768 1109 5.0E-32
sp|Q8DS46|RPOB_STRMU DNA-directed RNA polymerase subunit beta OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpoB PE=3 SV=1 768 1109 5.0E-32
sp|C1CGP4|RPOB_STRZJ DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain JJA) GN=rpoB PE=3 SV=1 768 1109 5.0E-32
sp|Q97NQ7|RPOB_STRPN DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpoB PE=3 SV=1 768 1109 5.0E-32
sp|B5E2F3|RPOB_STRP4 DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpoB PE=3 SV=1 768 1109 5.0E-32
sp|Q32RG0|RPOB_ZYGCR DNA-directed RNA polymerase subunit beta OS=Zygnema circumcarinatum GN=rpoB PE=3 SV=1 437 1110 6.0E-32
sp|B8G1V8|RPOB_DESHD DNA-directed RNA polymerase subunit beta OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rpoB PE=3 SV=1 768 1109 6.0E-32
sp|P46818|RPOB_SINAL DNA-directed RNA polymerase subunit beta OS=Sinapis alba GN=rpoB PE=1 SV=2 768 1113 6.0E-32
sp|Q250P0|RPOB_DESHY DNA-directed RNA polymerase subunit beta OS=Desulfitobacterium hafniense (strain Y51) GN=rpoB PE=3 SV=2 768 1109 6.0E-32
sp|A4QKI4|RPOB_CAPBU DNA-directed RNA polymerase subunit beta OS=Capsella bursa-pastoris GN=rpoB PE=3 SV=1 768 1113 6.0E-32
sp|Q67JT3|RPOB_SYMTH DNA-directed RNA polymerase subunit beta OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpoB PE=3 SV=1 768 1109 6.0E-32
sp|P50546|RPOB_ARATH DNA-directed RNA polymerase subunit beta OS=Arabidopsis thaliana GN=rpoB PE=3 SV=4 768 1113 6.0E-32
sp|B8ZNW7|RPOB_STRPJ DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpoB PE=3 SV=1 768 1109 6.0E-32
sp|C1CA06|RPOB_STRP7 DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain 70585) GN=rpoB PE=3 SV=1 768 1109 6.0E-32
sp|C1CTL4|RPOB_STRZT DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpoB PE=3 SV=1 768 1109 6.0E-32
sp|C1CMQ8|RPOB_STRZP DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain P1031) GN=rpoB PE=3 SV=1 768 1109 6.0E-32
sp|Q8DNF0|RPOB_STRR6 DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpoB PE=3 SV=2 768 1109 6.0E-32
sp|Q04IK6|RPOB_STRP2 DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpoB PE=3 SV=1 768 1109 6.0E-32
sp|A4QKS3|RPOB_CRUWA DNA-directed RNA polymerase subunit beta OS=Crucihimalaya wallichii GN=rpoB PE=3 SV=1 768 1113 7.0E-32
sp|Q85BW1|RPOB_ANTFO DNA-directed RNA polymerase subunit beta OS=Anthoceros formosae GN=rpoB PE=2 SV=1 768 1153 7.0E-32
sp|Q3M5D0|RPOB_ANAVT DNA-directed RNA polymerase subunit beta OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpoB PE=3 SV=1 768 1109 7.0E-32
sp|A4QJA7|RPOB_AETCO DNA-directed RNA polymerase subunit beta OS=Aethionema cordifolium GN=rpoB PE=3 SV=1 722 1113 7.0E-32
sp|A4QL11|RPOB_DRANE DNA-directed RNA polymerase subunit beta OS=Draba nemorosa GN=rpoB PE=3 SV=1 768 1113 8.0E-32
sp|A4QK97|RPOB_BARVE DNA-directed RNA polymerase subunit beta OS=Barbarea verna GN=rpoB PE=3 SV=1 768 1113 8.0E-32
sp|A4VSK2|RPOB_STRSY DNA-directed RNA polymerase subunit beta OS=Streptococcus suis (strain 05ZYH33) GN=rpoB PE=3 SV=1 768 1109 8.0E-32
sp|A4VYU3|RPOB_STRS2 DNA-directed RNA polymerase subunit beta OS=Streptococcus suis (strain 98HAH33) GN=rpoB PE=3 SV=1 768 1109 8.0E-32
sp|A4QJS5|RPOB_OLIPU DNA-directed RNA polymerase subunit beta OS=Olimarabidopsis pumila GN=rpoB PE=3 SV=1 768 1113 8.0E-32
sp|A4QL98|RPOB_LEPVR DNA-directed RNA polymerase subunit beta OS=Lepidium virginicum GN=rpoB PE=3 SV=1 768 1113 8.0E-32
sp|Q82Z40|RPOB_ENTFA DNA-directed RNA polymerase subunit beta OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpoB PE=3 SV=1 768 1109 9.0E-32
sp|Q5FM97|RPOB_LACAC DNA-directed RNA polymerase subunit beta OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpoB PE=3 SV=1 768 1109 9.0E-32
sp|A1BD23|RPOB_CHLPD DNA-directed RNA polymerase subunit beta OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rpoB PE=3 SV=1 880 1109 9.0E-32
sp|Q06GR8|RPOB_PIPCE DNA-directed RNA polymerase subunit beta OS=Piper cenocladum GN=rpoB PE=3 SV=1 768 1113 9.0E-32
sp|P41607|RPOB_PINTH DNA-directed RNA polymerase subunit beta OS=Pinus thunbergii GN=rpoB PE=3 SV=1 768 1113 1.0E-31
sp|A3CKD3|RPOB_STRSV DNA-directed RNA polymerase subunit beta OS=Streptococcus sanguinis (strain SK36) GN=rpoB PE=3 SV=2 768 1109 1.0E-31
sp|Q56P13|RPOB_LACSA DNA-directed RNA polymerase subunit beta OS=Lactuca sativa GN=rpoB PE=3 SV=2 768 1113 1.0E-31
sp|P49466|RPOB_ODOSI DNA-directed RNA polymerase subunit beta OS=Odontella sinensis GN=rpoB PE=3 SV=1 520 1109 1.0E-31
sp|A6MM28|RPOB_BUXMI DNA-directed RNA polymerase subunit beta OS=Buxus microphylla GN=rpoB PE=3 SV=1 768 1113 1.0E-31
sp|Q7NIA0|RPOB_GLOVI DNA-directed RNA polymerase subunit beta OS=Gloeobacter violaceus (strain PCC 7421) GN=rpoB PE=3 SV=1 768 1109 2.0E-31
sp|A4IJI1|RPOB_GEOTN DNA-directed RNA polymerase subunit beta OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpoB PE=3 SV=1 768 1109 2.0E-31
sp|Q5L405|RPOB_GEOKA DNA-directed RNA polymerase subunit beta OS=Geobacillus kaustophilus (strain HTA426) GN=rpoB PE=3 SV=1 768 1109 2.0E-31
sp|Q1AU22|RPOB_RUBXD DNA-directed RNA polymerase subunit beta OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpoB PE=3 SV=1 768 1109 2.0E-31
sp|Q02X59|RPOB_LACLS DNA-directed RNA polymerase subunit beta OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpoB PE=3 SV=1 768 1109 2.0E-31
sp|B9DSZ5|RPOB_STRU0 DNA-directed RNA polymerase subunit beta OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpoB PE=3 SV=1 768 1109 2.0E-31
sp|Q3A9Q7|RPOB_CARHZ DNA-directed RNA polymerase subunit beta OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpoB PE=3 SV=1 768 1109 2.0E-31
sp|A2RML9|RPOB_LACLM DNA-directed RNA polymerase subunit beta OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpoB PE=3 SV=1 768 1109 2.0E-31
sp|B5XJ72|RPOB_STRPZ DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rpoB PE=3 SV=1 768 1109 2.0E-31
sp|P0DF31|RPOB_STRPQ DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpoB PE=3 SV=1 768 1109 2.0E-31
sp|Q48VR1|RPOB_STRPM DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpoB PE=3 SV=1 768 1109 2.0E-31
sp|A2RC51|RPOB_STRPG DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpoB PE=3 SV=1 768 1109 2.0E-31
sp|Q1J8X1|RPOB_STRPF DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpoB PE=3 SV=1 768 1109 2.0E-31
sp|Q1JE20|RPOB_STRPB DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpoB PE=3 SV=1 768 1109 2.0E-31
sp|Q5XE97|RPOB_STRP6 DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpoB PE=3 SV=1 768 1109 2.0E-31
sp|P0DF30|RPOB_STRP3 DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpoB PE=3 SV=1 768 1109 2.0E-31
sp|Q9A1U1|RPOB_STRP1 DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M1 GN=rpoB PE=3 SV=1 768 1109 2.0E-31
sp|Q1JJ23|RPOB_STRPD DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpoB PE=3 SV=1 768 1109 3.0E-31
sp|Q8P2Y3|RPOB_STRP8 DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpoB PE=3 SV=1 768 1109 3.0E-31
sp|P48119|RPOB_CYAPA DNA-directed RNA polymerase subunit beta OS=Cyanophora paradoxa GN=rpoB PE=3 SV=1 768 1109 3.0E-31
sp|Q9CEN6|RPOB_LACLA DNA-directed RNA polymerase subunit beta OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpoB PE=3 SV=1 768 1109 3.0E-31
sp|Q5SCX8|RPOB_HUPLU DNA-directed RNA polymerase subunit beta OS=Huperzia lucidula GN=rpoB PE=3 SV=1 767 1113 3.0E-31
sp|Q1ACN6|RPOB_CHAVU DNA-directed RNA polymerase subunit beta OS=Chara vulgaris GN=rpoB PE=3 SV=2 768 1109 3.0E-31
sp|Q8E239|RPOB_STRA5 DNA-directed RNA polymerase subunit beta OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpoB PE=3 SV=1 768 1109 3.0E-31
sp|Q8E7J8|RPOB_STRA3 DNA-directed RNA polymerase subunit beta OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpoB PE=3 SV=1 768 1109 3.0E-31
sp|Q3K3L2|RPOB_STRA1 DNA-directed RNA polymerase subunit beta OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpoB PE=3 SV=1 768 1109 3.0E-31
sp|O83269|RPOB_TREPA DNA-directed RNA polymerase subunit beta OS=Treponema pallidum (strain Nichols) GN=rpoB PE=3 SV=1 768 1109 3.0E-31
sp|C0MEE3|RPOB_STRS7 DNA-directed RNA polymerase subunit beta OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpoB PE=3 SV=1 768 1109 3.0E-31
sp|Q0AUH2|RPOB_SYNWW DNA-directed RNA polymerase subunit beta OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpoB PE=3 SV=1 768 1109 3.0E-31
sp|B4U047|RPOB_STREM DNA-directed RNA polymerase subunit beta OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rpoB PE=3 SV=1 768 1109 3.0E-31
sp|C0M7C8|RPOB_STRE4 DNA-directed RNA polymerase subunit beta OS=Streptococcus equi subsp. equi (strain 4047) GN=rpoB PE=3 SV=1 768 1109 3.0E-31
sp|Q0SQD6|RPOB_CLOPS DNA-directed RNA polymerase subunit beta OS=Clostridium perfringens (strain SM101 / Type A) GN=rpoB PE=3 SV=1 768 1109 3.0E-31
sp|P0C2E7|RPOB_CLOPE DNA-directed RNA polymerase subunit beta OS=Clostridium perfringens (strain 13 / Type A) GN=rpoB PE=3 SV=1 768 1109 3.0E-31
sp|Q0TMN8|RPOB_CLOP1 DNA-directed RNA polymerase subunit beta OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpoB PE=3 SV=1 768 1109 3.0E-31
sp|Q8GCR6|RPOB1_ENTFC DNA-directed RNA polymerase subunit beta OS=Enterococcus faecium GN=rpoB PE=3 SV=1 768 1109 4.0E-31
sp|Q8GCR4|RPOB2_ENTFC DNA-directed RNA polymerase subunit beta OS=Enterococcus faecium GN=rpoB PE=3 SV=1 768 1109 4.0E-31
sp|Q09G54|RPOB_PLAOC DNA-directed RNA polymerase subunit beta OS=Platanus occidentalis GN=rpoB PE=3 SV=1 768 1113 4.0E-31
sp|Q2ST48|RPOB_MYCCT DNA-directed RNA polymerase subunit beta OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rpoB PE=3 SV=1 768 1109 4.0E-31
sp|Q8GCR5|RPOB3_ENTFC DNA-directed RNA polymerase subunit beta OS=Enterococcus faecium GN=rpoB PE=3 SV=1 768 1109 5.0E-31
sp|Q1KXX2|RPOB_HELAN DNA-directed RNA polymerase subunit beta OS=Helianthus annuus GN=rpoB PE=3 SV=1 768 1113 5.0E-31
sp|Q09MI6|RPOB_CITSI DNA-directed RNA polymerase subunit beta OS=Citrus sinensis GN=rpoB PE=3 SV=1 768 1113 5.0E-31
sp|A1E9I1|RPOB_HORVU DNA-directed RNA polymerase subunit beta OS=Hordeum vulgare GN=rpoB PE=3 SV=1 768 1110 5.0E-31
sp|A0ZZ27|RPOB_GOSBA DNA-directed RNA polymerase subunit beta OS=Gossypium barbadense GN=rpoB PE=3 SV=1 768 1113 6.0E-31
sp|Q8S8X9|RPOB_ATRBE DNA-directed RNA polymerase subunit beta OS=Atropa belladonna GN=rpoB PE=3 SV=1 768 1113 6.0E-31
sp|P37870|RPOB_BACSU DNA-directed RNA polymerase subunit beta OS=Bacillus subtilis (strain 168) GN=rpoB PE=1 SV=2 768 1109 7.0E-31
sp|A4QJJ1|RPOB_AETGR DNA-directed RNA polymerase subunit beta OS=Aethionema grandiflorum GN=rpoB PE=3 SV=1 768 1113 7.0E-31
sp|Q9Z9M2|RPOB_BACHD DNA-directed RNA polymerase subunit beta OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpoB PE=3 SV=1 768 1109 7.0E-31
sp|P77965|RPOB_SYNY3 DNA-directed RNA polymerase subunit beta OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpoB PE=3 SV=1 768 1109 7.0E-31
sp|Q2VEI4|RPOB_SOLTU DNA-directed RNA polymerase subunit beta OS=Solanum tuberosum GN=rpoB PE=3 SV=1 768 1113 7.0E-31
sp|Q0G9X0|RPOB_DAUCA DNA-directed RNA polymerase subunit beta OS=Daucus carota GN=rpoB PE=3 SV=1 768 1113 8.0E-31
sp|Q09FW9|RPOB_NANDO DNA-directed RNA polymerase subunit beta OS=Nandina domestica GN=rpoB PE=3 SV=1 768 1113 8.0E-31
sp|Q9XPS7|RPOB_WHEAT DNA-directed RNA polymerase subunit beta OS=Triticum aestivum GN=rpoB PE=3 SV=1 768 1110 8.0E-31
sp|Q2L8Z9|RPOB_GOSHI DNA-directed RNA polymerase subunit beta OS=Gossypium hirsutum GN=rpoB PE=3 SV=1 768 1113 9.0E-31
sp|A1E9Z8|RPOB_AGRST DNA-directed RNA polymerase subunit beta OS=Agrostis stolonifera GN=rpoB PE=3 SV=1 768 1110 9.0E-31
sp|Q33C46|RPOB_NICTO DNA-directed RNA polymerase subunit beta OS=Nicotiana tomentosiformis GN=rpoB PE=3 SV=1 768 1113 9.0E-31
sp|A7Z0M9|RPOB_BACMF DNA-directed RNA polymerase subunit beta OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpoB PE=3 SV=1 768 1109 1.0E-30
sp|P0C503|RPOB_ORYSJ DNA-directed RNA polymerase subunit beta OS=Oryza sativa subsp. japonica GN=rpoB PE=3 SV=1 768 1110 1.0E-30
sp|P0C502|RPOB_ORYSI DNA-directed RNA polymerase subunit beta OS=Oryza sativa subsp. indica GN=rpoB PE=3 SV=1 768 1110 1.0E-30
sp|P0C501|RPOB_ORYSA DNA-directed RNA polymerase subunit beta OS=Oryza sativa GN=rpoB PE=3 SV=1 768 1110 1.0E-30
sp|Q6ENI4|RPOB_ORYNI DNA-directed RNA polymerase subunit beta OS=Oryza nivara GN=rpoB PE=3 SV=1 768 1110 1.0E-30
sp|P06271|RPOB_TOBAC DNA-directed RNA polymerase subunit beta OS=Nicotiana tabacum GN=rpoB PE=3 SV=1 768 1113 1.0E-30
sp|Q3C1G7|RPOB_NICSY DNA-directed RNA polymerase subunit beta OS=Nicotiana sylvestris GN=rpoB PE=3 SV=1 768 1113 1.0E-30
sp|Q7URW6|RPOB_RHOBA DNA-directed RNA polymerase subunit beta OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rpoB PE=3 SV=2 902 1109 1.0E-30
sp|Q8KG15|RPOB_CHLTE DNA-directed RNA polymerase subunit beta OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rpoB PE=3 SV=1 846 1109 1.0E-30
sp|Q73JJ7|RPOB_TREDE DNA-directed RNA polymerase subunit beta OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rpoB PE=3 SV=1 768 1134 1.0E-30
sp|Q5MZ23|RPOB_SYNP6 DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpoB PE=3 SV=1 768 1109 1.0E-30
sp|Q31N17|RPOB_SYNE7 DNA-directed RNA polymerase subunit beta OS=Synechococcus elongatus (strain PCC 7942) GN=rpoB PE=3 SV=1 768 1109 1.0E-30
sp|Q49L06|RPOB_EUCGG DNA-directed RNA polymerase subunit beta OS=Eucalyptus globulus subsp. globulus GN=rpoB PE=3 SV=1 768 1113 1.0E-30
sp|Q06FW9|RPOB_PELHO DNA-directed RNA polymerase subunit beta OS=Pelargonium hortorum GN=rpoB PE=3 SV=1 768 1115 2.0E-30
sp|Q6L3A7|RPOB_SACHY DNA-directed RNA polymerase subunit beta OS=Saccharum hybrid GN=rpoB PE=2 SV=2 768 1110 2.0E-30
sp|Q6ENX3|RPOB_SACOF DNA-directed RNA polymerase subunit beta OS=Saccharum officinarum GN=rpoB PE=3 SV=1 768 1110 2.0E-30
sp|Q110H1|RPOB_TRIEI DNA-directed RNA polymerase subunit beta OS=Trichodesmium erythraeum (strain IMS101) GN=rpoB PE=3 SV=1 768 1109 2.0E-30
sp|Q6MRX6|RPOB_MYCMS DNA-directed RNA polymerase subunit beta OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rpoB PE=3 SV=1 768 1109 2.0E-30
sp|A1E9R4|RPOB_SORBI DNA-directed RNA polymerase subunit beta OS=Sorghum bicolor GN=rpoB PE=3 SV=1 768 1110 2.0E-30
sp|A6MMT6|RPOB_ILLOL DNA-directed RNA polymerase subunit beta OS=Illicium oligandrum GN=rpoB PE=3 SV=2 768 1113 2.0E-30
sp|Q0ZJ28|RPOB_VITVI DNA-directed RNA polymerase subunit beta OS=Vitis vinifera GN=rpoB PE=3 SV=1 768 1113 2.0E-30
sp|P16023|RPOB_MAIZE DNA-directed RNA polymerase subunit beta OS=Zea mays GN=rpoB PE=3 SV=1 768 1110 2.0E-30
sp|Q09X25|RPOB_MORIN DNA-directed RNA polymerase subunit beta OS=Morus indica GN=rpoB PE=3 SV=1 768 1113 2.0E-30
sp|B3WAM8|RPOB_LACCB DNA-directed RNA polymerase subunit beta OS=Lactobacillus casei (strain BL23) GN=rpoB PE=3 SV=1 768 1109 2.0E-30
sp|Q68S14|RPOB_PANGI DNA-directed RNA polymerase subunit beta OS=Panax ginseng GN=rpoB PE=3 SV=1 768 1113 2.0E-30
sp|Q8GCR3|RPOB4_ENTFC DNA-directed RNA polymerase subunit beta OS=Enterococcus faecium GN=rpoB PE=3 SV=1 768 1109 2.0E-30
sp|Q034X0|RPOB_LACC3 DNA-directed RNA polymerase subunit beta OS=Lactobacillus casei (strain ATCC 334) GN=rpoB PE=3 SV=1 768 1109 2.0E-30
sp|A8F976|RPOB_BACP2 DNA-directed RNA polymerase subunit beta OS=Bacillus pumilus (strain SAFR-032) GN=rpoB PE=3 SV=1 768 1109 2.0E-30
sp|A8Y9G0|RPOB_LOLPR DNA-directed RNA polymerase subunit beta OS=Lolium perenne GN=rpoB PE=3 SV=1 768 1110 2.0E-30
sp|Q2MIA8|RPOB_SOLLC DNA-directed RNA polymerase subunit beta OS=Solanum lycopersicum GN=rpoB PE=3 SV=1 768 1113 3.0E-30
sp|Q2MIJ5|RPOB_SOLBU DNA-directed RNA polymerase subunit beta OS=Solanum bulbocastanum GN=rpoB PE=3 SV=1 768 1113 3.0E-30
sp|Q06RD9|RPOB_JASNU DNA-directed RNA polymerase subunit beta OS=Jasminum nudiflorum GN=rpoB PE=3 SV=1 768 1113 3.0E-30
sp|B0SSI4|RPOB_LEPBP DNA-directed RNA polymerase subunit beta OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=rpoB PE=3 SV=1 768 1109 3.0E-30
sp|Q9KK59|RPOB_LEPBI DNA-directed RNA polymerase subunit beta OS=Leptospira biflexa GN=rpoB PE=3 SV=1 768 1109 3.0E-30
sp|B0KCJ2|RPOB_THEP3 DNA-directed RNA polymerase subunit beta OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpoB PE=3 SV=1 768 1109 3.0E-30
sp|B0SAG1|RPOB_LEPBA DNA-directed RNA polymerase subunit beta OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=rpoB PE=3 SV=1 768 1109 3.0E-30
sp|A6MVX4|RPOB_RHDSA DNA-directed RNA polymerase subunit beta OS=Rhodomonas salina GN=rpoB PE=3 SV=1 768 1109 3.0E-30
sp|A6TWJ0|RPOB_ALKMQ DNA-directed RNA polymerase subunit beta OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpoB PE=3 SV=1 768 1109 4.0E-30
sp|B0K5G8|RPOB_THEPX DNA-directed RNA polymerase subunit beta OS=Thermoanaerobacter sp. (strain X514) GN=rpoB PE=3 SV=1 768 1109 4.0E-30
sp|A5I7L4|RPOB_CLOBH DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpoB PE=3 SV=1 768 1109 4.0E-30
sp|A7FZ77|RPOB_CLOB1 DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpoB PE=3 SV=1 768 1109 4.0E-30
sp|B1IGG2|RPOB_CLOBK DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Okra / Type B1) GN=rpoB PE=3 SV=1 768 1109 4.0E-30
sp|A7Y3B9|RPOB_IPOPU DNA-directed RNA polymerase subunit beta OS=Ipomoea purpurea GN=rpoB PE=3 SV=1 768 1113 4.0E-30
sp|C1FMV9|RPOB_CLOBJ DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rpoB PE=3 SV=1 768 1109 5.0E-30
sp|A7GJ82|RPOB_CLOBL DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpoB PE=3 SV=1 768 1109 5.0E-30
sp|Q65PB5|RPOB_BACLD DNA-directed RNA polymerase subunit beta OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpoB PE=3 SV=1 768 1109 5.0E-30
sp|A0AF63|RPOB_LISW6 DNA-directed RNA polymerase subunit beta OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpoB PE=3 SV=1 768 1109 6.0E-30
sp|A5USR7|RPOB_ROSS1 DNA-directed RNA polymerase subunit beta OS=Roseiflexus sp. (strain RS-1) GN=rpoB PE=3 SV=1 768 1109 6.0E-30
sp|Q9RLT9|RPOB_LISMO DNA-directed RNA polymerase subunit beta OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpoB PE=3 SV=1 768 1109 6.0E-30
sp|Q724F0|RPOB_LISMF DNA-directed RNA polymerase subunit beta OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpoB PE=3 SV=1 768 1109 6.0E-30
sp|C1KYJ3|RPOB_LISMC DNA-directed RNA polymerase subunit beta OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpoB PE=3 SV=1 768 1109 6.0E-30
sp|Q9MTM5|RPOB_OENEH DNA-directed RNA polymerase subunit beta OS=Oenothera elata subsp. hookeri GN=rpoB PE=3 SV=2 768 1113 6.0E-30
sp|Q92F22|RPOB_LISIN DNA-directed RNA polymerase subunit beta OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpoB PE=3 SV=1 768 1109 7.0E-30
sp|B1KSN3|RPOB_CLOBM DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpoB PE=3 SV=1 768 1109 7.0E-30
sp|Q4VZP1|RPOB_CUCSA DNA-directed RNA polymerase subunit beta OS=Cucumis sativus GN=rpoB PE=3 SV=2 768 1113 7.0E-30
sp|C3KVQ9|RPOB_CLOB6 DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rpoB PE=3 SV=1 768 1109 7.0E-30
sp|Q8HVY5|RPOB_SOYBN DNA-directed RNA polymerase subunit beta OS=Glycine max GN=rpoB PE=3 SV=2 768 1113 7.0E-30
sp|B8DEY8|RPOB_LISMH DNA-directed RNA polymerase subunit beta OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rpoB PE=3 SV=1 768 1109 7.0E-30
sp|A4GGA5|RPOB_PHAVU DNA-directed RNA polymerase subunit beta OS=Phaseolus vulgaris GN=rpoB PE=3 SV=1 768 1113 8.0E-30
sp|A9L988|RPOB_LEMMI DNA-directed RNA polymerase subunit beta OS=Lemna minor GN=rpoB PE=3 SV=1 768 1113 8.0E-30
sp|Q4G3A7|RPOB_EMIHU DNA-directed RNA polymerase subunit beta OS=Emiliania huxleyi GN=rpoB PE=3 SV=1 768 1109 8.0E-30
sp|Q14FG5|RPOB_POPAL DNA-directed RNA polymerase subunit beta OS=Populus alba GN=rpoB PE=3 SV=1 768 1113 9.0E-30
sp|Q38UQ2|RPOB_LACSS DNA-directed RNA polymerase subunit beta OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpoB PE=3 SV=1 768 1109 9.0E-30
sp|A4GYQ0|RPOB_POPTR DNA-directed RNA polymerase subunit beta OS=Populus trichocarpa GN=rpoB PE=3 SV=1 768 1113 1.0E-29
sp|Q8R7U6|RPOB_CALS4 DNA-directed RNA polymerase subunit beta OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpoB PE=3 SV=1 768 1109 1.0E-29
sp|Q3ZJ93|RPOB_PSEAK DNA-directed RNA polymerase subunit beta OS=Pseudendoclonium akinetum GN=rpoB PE=3 SV=1 877 1109 1.0E-29
sp|A6MMB4|RPOB_CHLSC DNA-directed RNA polymerase subunit beta OS=Chloranthus spicatus GN=rpoB PE=3 SV=1 768 1113 1.0E-29
sp|A8W3B6|RPOB_CUSEX DNA-directed RNA polymerase subunit beta OS=Cuscuta exaltata GN=rpoB PE=3 SV=1 768 1113 1.0E-29
sp|A6LPQ4|RPOB_CLOB8 DNA-directed RNA polymerase subunit beta OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpoB PE=3 SV=1 768 1188 1.0E-29
sp|Q2S1Q5|RPOB_SALRD DNA-directed RNA polymerase subunit beta OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rpoB PE=3 SV=2 866 1109 1.0E-29
sp|A4J103|RPOB_DESRM DNA-directed RNA polymerase subunit beta OS=Desulfotomaculum reducens (strain MI-1) GN=rpoB PE=3 SV=1 768 1109 1.0E-29
sp|Q8ETY8|RPOB_OCEIH DNA-directed RNA polymerase subunit beta OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpoB PE=3 SV=1 768 1111 2.0E-29
sp|A9B6J3|RPOB_HERA2 DNA-directed RNA polymerase subunit beta OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rpoB PE=3 SV=1 768 1109 2.0E-29
sp|Q0I7L7|RPOB_SYNS3 DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain CC9311) GN=rpoB PE=3 SV=1 768 1109 2.0E-29
sp|A0A327|RPOB_COFAR DNA-directed RNA polymerase subunit beta OS=Coffea arabica GN=rpoB PE=3 SV=1 768 1113 2.0E-29
sp|B3E163|RPOB_METI4 DNA-directed RNA polymerase subunit beta OS=Methylacidiphilum infernorum (isolate V4) GN=rpoB PE=3 SV=1 897 1109 2.0E-29
sp|A5GNH3|RPOB_SYNPW DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain WH7803) GN=rpoB PE=3 SV=1 768 1109 2.0E-29
sp|A3PEX4|RPOB_PROM0 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9301) GN=rpoB PE=3 SV=1 768 1109 2.0E-29
sp|Q93GF2|RPOB_TROWT DNA-directed RNA polymerase subunit beta OS=Tropheryma whipplei (strain Twist) GN=rpoB PE=3 SV=2 484 1109 2.0E-29
sp|A6H5F9|RPOB_CYCTA DNA-directed RNA polymerase subunit beta OS=Cycas taitungensis GN=rpoB PE=3 SV=1 768 1110 2.0E-29
sp|Q589C0|RPOB_SILLA DNA-directed RNA polymerase subunit beta OS=Silene latifolia GN=rpoB PE=3 SV=1 768 1113 2.0E-29
sp|A7M958|RPOB_CUSRE DNA-directed RNA polymerase subunit beta OS=Cuscuta reflexa GN=rpoB PE=2 SV=2 768 1113 2.0E-29
sp|Q7V5P1|RPOB_PROMM DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9313) GN=rpoB PE=3 SV=1 768 1109 2.0E-29
sp|Q7YJX8|RPOB_CALFG DNA-directed RNA polymerase subunit beta OS=Calycanthus floridus var. glaucus GN=rpoB PE=3 SV=1 768 1113 2.0E-29
sp|A0PXT8|RPOB_CLONN DNA-directed RNA polymerase subunit beta OS=Clostridium novyi (strain NT) GN=rpoB PE=3 SV=1 762 1190 2.0E-29
sp|P60282|RPOB_AMBTC DNA-directed RNA polymerase subunit beta OS=Amborella trichopoda GN=rpoB PE=3 SV=2 768 1113 2.0E-29
sp|Q3V542|RPOB_ACOCL DNA-directed RNA polymerase subunit beta OS=Acorus calamus GN=rpoB PE=3 SV=2 768 1113 2.0E-29
sp|Q5QA72|RPOB_ACOGR DNA-directed RNA polymerase subunit beta OS=Acorus gramineus GN=rpoB PE=3 SV=1 768 1113 3.0E-29
sp|P59642|RPOB_TROW8 DNA-directed RNA polymerase subunit beta OS=Tropheryma whipplei (strain TW08/27) GN=rpoB PE=3 SV=1 484 1109 3.0E-29
sp|A5N4N9|RPOB_CLOK5 DNA-directed RNA polymerase subunit beta OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpoB PE=3 SV=1 768 1109 3.0E-29
sp|B9DYA1|RPOB_CLOK1 DNA-directed RNA polymerase subunit beta OS=Clostridium kluyveri (strain NBRC 12016) GN=rpoB PE=3 SV=1 768 1109 3.0E-29
sp|Q81J48|RPOB_BACCR DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpoB PE=3 SV=1 768 1109 3.0E-29
sp|B7HJ40|RPOB_BACC4 DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain B4264) GN=rpoB PE=3 SV=1 768 1109 3.0E-29
sp|B7IT11|RPOB_BACC2 DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain G9842) GN=rpoB PE=3 SV=1 768 1109 3.0E-29
sp|Q6HPR6|RPOB_BACHK DNA-directed RNA polymerase subunit beta OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpoB PE=3 SV=1 768 1109 3.0E-29
sp|Q63H98|RPOB_BACCZ DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain ZK / E33L) GN=rpoB PE=3 SV=1 768 1109 3.0E-29
sp|B9IZI6|RPOB_BACCQ DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain Q1) GN=rpoB PE=3 SV=1 768 1109 3.0E-29
sp|B7HQT6|RPOB_BACC7 DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain AH187) GN=rpoB PE=3 SV=1 768 1109 3.0E-29
sp|C1ET31|RPOB_BACC3 DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain 03BB102) GN=rpoB PE=3 SV=1 768 1109 3.0E-29
sp|Q73FA4|RPOB_BACC1 DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpoB PE=3 SV=1 768 1109 3.0E-29
sp|A0R8H2|RPOB_BACAH DNA-directed RNA polymerase subunit beta OS=Bacillus thuringiensis (strain Al Hakam) GN=rpoB PE=3 SV=2 768 1109 3.0E-29
sp|Q81VT8|RPOB_BACAN DNA-directed RNA polymerase subunit beta OS=Bacillus anthracis GN=rpoB PE=3 SV=1 768 1109 3.0E-29
sp|C3LJ74|RPOB_BACAC DNA-directed RNA polymerase subunit beta OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rpoB PE=3 SV=1 768 1109 3.0E-29
sp|C3P9P7|RPOB_BACAA DNA-directed RNA polymerase subunit beta OS=Bacillus anthracis (strain A0248) GN=rpoB PE=3 SV=1 768 1109 3.0E-29
sp|Q6KI09|RPOB_MYCMO DNA-directed RNA polymerase subunit beta OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=rpoB PE=3 SV=1 768 1170 3.0E-29
sp|A9LYH7|RPOB_ACOAM DNA-directed RNA polymerase subunit beta OS=Acorus americanus GN=rpoB PE=3 SV=1 768 1113 3.0E-29
sp|A2BT61|RPOB_PROMS DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain AS9601) GN=rpoB PE=3 SV=1 768 1109 3.0E-29
sp|Q6A6K6|RPOB_PROAC DNA-directed RNA polymerase subunit beta OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rpoB PE=3 SV=1 520 1109 3.0E-29
sp|A2C6S8|RPOB_PROM3 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9303) GN=rpoB PE=3 SV=1 768 1109 3.0E-29
sp|A9VP69|RPOB_BACWK DNA-directed RNA polymerase subunit beta OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpoB PE=3 SV=1 768 1109 3.0E-29
sp|A8G6Y6|RPOB_PROM2 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9215) GN=rpoB PE=3 SV=1 768 1109 4.0E-29
sp|A6MMJ9|RPOB_DIOEL DNA-directed RNA polymerase subunit beta OS=Dioscorea elephantipes GN=rpoB PE=3 SV=1 768 1113 4.0E-29
sp|A0T0R1|RPOB_THAPS DNA-directed RNA polymerase subunit beta OS=Thalassiosira pseudonana GN=rpoB PE=3 SV=1 768 1109 4.0E-29
sp|Q8HTL7|RPOB2_CHLRE DNA-directed RNA polymerase subunit beta C-terminal section OS=Chlamydomonas reinhardtii GN=rpoB2 PE=2 SV=1 768 1109 4.0E-29
sp|Q2JX64|RPOB_SYNJA DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain JA-3-3Ab) GN=rpoB PE=3 SV=1 768 1109 5.0E-29
sp|Q1JNX8|RPOB_STRPC DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpoB PE=3 SV=2 768 1109 5.0E-29
sp|Q6EW56|RPOB_NYMAL DNA-directed RNA polymerase subunit beta OS=Nymphaea alba GN=rpoB PE=3 SV=1 768 1113 5.0E-29
sp|P11703|RPOB_SPIOL DNA-directed RNA polymerase subunit beta OS=Spinacia oleracea GN=rpoB PE=3 SV=1 768 1113 5.0E-29
sp|Q4A7A9|RPOB_MYCH7 DNA-directed RNA polymerase subunit beta OS=Mycoplasma hyopneumoniae (strain 7448) GN=rpoB PE=3 SV=1 768 1109 5.0E-29
sp|A4FPP3|RPOB_SACEN DNA-directed RNA polymerase subunit beta OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rpoB PE=3 SV=1 768 1109 6.0E-29
sp|Q5ZZS1|RPOB_MYCH2 DNA-directed RNA polymerase subunit beta OS=Mycoplasma hyopneumoniae (strain 232) GN=rpoB PE=3 SV=1 768 1109 7.0E-29
sp|Q19V98|RPOB_CHLAT DNA-directed RNA polymerase subunit beta OS=Chlorokybus atmophyticus GN=rpoB PE=3 SV=2 768 1109 7.0E-29
sp|Q97EG9|RPOB_CLOAB DNA-directed RNA polymerase subunit beta OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpoB PE=3 SV=1 768 1109 7.0E-29
sp|P56299|RPOB_CHLVU DNA-directed RNA polymerase subunit beta OS=Chlorella vulgaris GN=rpoB PE=3 SV=1 768 1109 7.0E-29
sp|Q2JJ19|RPOB_SYNJB DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rpoB PE=3 SV=1 768 1109 7.0E-29
sp|A2C4N2|RPOB_PROM1 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain NATL1A) GN=rpoB PE=3 SV=1 768 1109 7.0E-29
sp|Q6B8R8|RPOB_GRATL DNA-directed RNA polymerase subunit beta OS=Gracilaria tenuistipitata var. liui GN=rpoB PE=3 SV=1 768 1109 8.0E-29
sp|Q8RQE9|RPOB_THET8 DNA-directed RNA polymerase subunit beta OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpoB PE=1 SV=1 768 1109 9.0E-29
sp|Q46J22|RPOB_PROMT DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain NATL2A) GN=rpoB PE=3 SV=1 768 1109 9.0E-29
sp|Q4A969|RPOB_MYCHJ DNA-directed RNA polymerase subunit beta OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=rpoB PE=3 SV=1 768 1109 1.0E-28
sp|Q318Q7|RPOB_PROM9 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9312) GN=rpoB PE=3 SV=1 768 1109 1.0E-28
sp|Q890N4|RPOB_CLOTE DNA-directed RNA polymerase subunit beta OS=Clostridium tetani (strain Massachusetts / E88) GN=rpoB PE=3 SV=1 768 1109 1.0E-28
sp|Q72HM5|RPOB_THET2 DNA-directed RNA polymerase subunit beta OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpoB PE=3 SV=1 768 1109 1.0E-28
sp|P59643|RPOB_TROWH DNA-directed RNA polymerase subunit beta OS=Tropheryma whipplei GN=rpoB PE=3 SV=1 484 1109 1.0E-28
sp|Q7VA29|RPOB_PROMA DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rpoB PE=3 SV=1 768 1109 1.0E-28
sp|Q2JFI5|RPOB_FRASC DNA-directed RNA polymerase subunit beta OS=Frankia sp. (strain CcI3) GN=rpoB PE=3 SV=1 768 1109 1.0E-28
sp|A9BCH6|RPOB_PROM4 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9211) GN=rpoB PE=3 SV=1 768 1109 1.0E-28
sp|Q3BAP8|RPOB_PHAAO DNA-directed RNA polymerase subunit beta OS=Phalaenopsis aphrodite subsp. formosana GN=rpoB PE=3 SV=2 768 1113 1.0E-28
sp|Q0P3M6|RPOB_OSTTA DNA-directed RNA polymerase subunit beta OS=Ostreococcus tauri GN=rpoB PE=3 SV=1 768 1109 1.0E-28
sp|Q9BBS9|RPOB_LOTJA DNA-directed RNA polymerase subunit beta OS=Lotus japonicus GN=rpoB PE=3 SV=1 768 1113 1.0E-28
sp|A8LC64|RPOB_FRASN DNA-directed RNA polymerase subunit beta OS=Frankia sp. (strain EAN1pec) GN=rpoB PE=3 SV=1 768 1109 1.0E-28
sp|Q3B1H7|RPOB_CHLL7 DNA-directed RNA polymerase subunit beta OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rpoB PE=3 SV=1 906 1109 2.0E-28
sp|Q47LI5|RPOB_THEFY DNA-directed RNA polymerase subunit beta OS=Thermobifida fusca (strain YX) GN=rpoB PE=3 SV=1 768 1109 2.0E-28
sp|P23579|RPOB_EUGGR DNA-directed RNA polymerase subunit beta OS=Euglena gracilis GN=rpoB PE=3 SV=1 768 1109 2.0E-28
sp|A5GVF3|RPOB_SYNR3 DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain RCC307) GN=rpoB PE=3 SV=2 768 1109 2.0E-28
sp|Q82DQ5|RPOB_STRAW DNA-directed RNA polymerase subunit beta OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rpoB PE=3 SV=2 768 1109 2.0E-28
sp|Q9Z9A0|RPOB_CHLPN DNA-directed RNA polymerase subunit beta OS=Chlamydia pneumoniae GN=rpoB PE=3 SV=1 785 1109 2.0E-28
sp|Q06H05|RPOB_DRIGR DNA-directed RNA polymerase subunit beta OS=Drimys granadensis GN=rpoB PE=3 SV=1 768 1113 2.0E-28
sp|Q0RRT0|RPOB_FRAAA DNA-directed RNA polymerase subunit beta OS=Frankia alni (strain ACN14a) GN=rpoB PE=3 SV=1 768 1109 3.0E-28
sp|A8SE86|RPOB_CERDE DNA-directed RNA polymerase subunit beta OS=Ceratophyllum demersum GN=rpoB PE=3 SV=1 768 1113 3.0E-28
sp|Q0G9M7|RPOB_LIRTU DNA-directed RNA polymerase subunit beta OS=Liriodendron tulipifera GN=rpoB PE=3 SV=2 768 1113 3.0E-28
sp|A6BM50|RPOB_GNEPA DNA-directed RNA polymerase subunit beta OS=Gnetum parvifolium GN=rpoB PE=3 SV=1 768 1113 4.0E-28
sp|A8Z5T3|RPOB_SULMW DNA-directed RNA polymerase subunit beta OS=Sulcia muelleri (strain GWSS) GN=rpoB PE=3 SV=1 900 1109 4.0E-28
sp|A6LE81|RPOB_PARD8 DNA-directed RNA polymerase subunit beta OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpoB PE=3 SV=1 881 1109 4.0E-28
sp|Q9KWU7|RPOB_THEAQ DNA-directed RNA polymerase subunit beta OS=Thermus aquaticus GN=rpoB PE=1 SV=1 768 1109 5.0E-28
sp|Q7V006|RPOB_PROMP DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rpoB PE=3 SV=1 768 1109 5.0E-28
sp|A2BYL1|RPOB_PROM5 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9515) GN=rpoB PE=3 SV=1 768 1109 5.0E-28
sp|Q3ATP5|RPOB_CHLCH DNA-directed RNA polymerase subunit beta OS=Chlorobium chlorochromatii (strain CaD3) GN=rpoB PE=3 SV=1 906 1109 6.0E-28
sp|Q9TL06|RPOB_NEPOL DNA-directed RNA polymerase subunit beta OS=Nephroselmis olivacea GN=rpoB PE=3 SV=1 768 1109 7.0E-28
sp|Q7U8K4|RPOB_SYNPX DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain WH8102) GN=rpoB PE=3 SV=1 768 1109 7.0E-28
sp|Q01VB1|RPOB_SOLUE DNA-directed RNA polymerase subunit beta OS=Solibacter usitatus (strain Ellin6076) GN=rpoB PE=3 SV=2 910 1115 7.0E-28
sp|P06272|RPOB_MARPO DNA-directed RNA polymerase subunit beta OS=Marchantia polymorpha GN=rpoB PE=3 SV=1 768 1113 8.0E-28
sp|C4LL71|RPOB_CORK4 DNA-directed RNA polymerase subunit beta OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rpoB PE=3 SV=1 768 1109 9.0E-28
sp|A0JZ93|RPOB_ARTS2 DNA-directed RNA polymerase subunit beta OS=Arthrobacter sp. (strain FB24) GN=rpoB PE=3 SV=1 768 1109 9.0E-28
sp|P60281|RPOB_MYCS2 DNA-directed RNA polymerase subunit beta OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpoB PE=1 SV=1 768 1111 1.0E-27
sp|P36440|RPOB_HETAK DNA-directed RNA polymerase subunit beta OS=Heterosigma akashiwo GN=rpoB PE=3 SV=1 768 1109 1.0E-27
sp|Q6MDM1|RPOB_PARUW DNA-directed RNA polymerase subunit beta OS=Protochlamydia amoebophila (strain UWE25) GN=rpoB PE=3 SV=1 854 1109 2.0E-27
sp|Q3AHX5|RPOB_SYNSC DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain CC9605) GN=rpoB PE=3 SV=1 768 1109 2.0E-27
sp|Q9L0L0|RPOB_STRCO DNA-directed RNA polymerase subunit beta OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rpoB PE=1 SV=1 768 1109 2.0E-27
sp|B0TC48|RPOB_HELMI DNA-directed RNA polymerase subunit beta OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpoB PE=3 SV=1 768 1109 2.0E-27
sp|Q9TM35|RPOB_CYACA DNA-directed RNA polymerase subunit beta OS=Cyanidium caldarium GN=rpoB PE=3 SV=1 768 1109 3.0E-27
sp|Q255E6|RPOB_CHLFF DNA-directed RNA polymerase subunit beta OS=Chlamydophila felis (strain Fe/C-56) GN=rpoB PE=3 SV=1 785 1109 3.0E-27
sp|A1R8V4|RPOB_ARTAT DNA-directed RNA polymerase subunit beta OS=Arthrobacter aurescens (strain TC1) GN=rpoB PE=3 SV=1 768 1109 3.0E-27
sp|Q3AZA4|RPOB_SYNS9 DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain CC9902) GN=rpoB PE=3 SV=1 768 1109 3.0E-27
sp|P51252|RPOB_PORPU DNA-directed RNA polymerase subunit beta OS=Porphyra purpurea GN=rpoB PE=3 SV=1 768 1109 3.0E-27
sp|Q1BDF0|RPOB_MYCSS DNA-directed RNA polymerase subunit beta OS=Mycobacterium sp. (strain MCS) GN=rpoB PE=3 SV=2 768 1111 3.0E-27
sp|A1UBJ3|RPOB_MYCSK DNA-directed RNA polymerase subunit beta OS=Mycobacterium sp. (strain KMS) GN=rpoB PE=3 SV=1 768 1111 3.0E-27
sp|A3PV78|RPOB_MYCSJ DNA-directed RNA polymerase subunit beta OS=Mycobacterium sp. (strain JLS) GN=rpoB PE=3 SV=1 768 1111 4.0E-27
sp|Q822J1|RPOB_CHLCV DNA-directed RNA polymerase subunit beta OS=Chlamydophila caviae (strain GPIC) GN=rpoB PE=3 SV=1 785 1109 4.0E-27
sp|Q1KVX5|RPOB2_ACUOB DNA-directed RNA polymerase subunit beta C-terminal section OS=Acutodesmus obliquus GN=rpoB2 PE=3 SV=1 768 1109 5.0E-27
sp|Q5L5I3|RPOB_CHLAB DNA-directed RNA polymerase subunit beta OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpoB PE=3 SV=1 785 1109 6.0E-27
sp|A6LKB8|RPOB_THEM4 DNA-directed RNA polymerase subunit beta OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpoB PE=3 SV=1 768 1112 6.0E-27
sp|Q9RVV9|RPOB_DEIRA DNA-directed RNA polymerase subunit beta OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpoB PE=3 SV=2 768 1109 6.0E-27
sp|Q11QA5|RPOB_CYTH3 DNA-directed RNA polymerase subunit beta OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rpoB PE=3 SV=1 858 1109 6.0E-27
sp|A4T1P4|RPOB_MYCGI DNA-directed RNA polymerase subunit beta OS=Mycobacterium gilvum (strain PYR-GCK) GN=rpoB PE=3 SV=1 768 1111 7.0E-27
sp|A6GYU0|RPOB_FLAPJ DNA-directed RNA polymerase subunit beta OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rpoB PE=3 SV=1 852 1109 9.0E-27
sp|A0PM24|RPOB_MYCUA DNA-directed RNA polymerase subunit beta OS=Mycobacterium ulcerans (strain Agy99) GN=rpoB PE=3 SV=1 657 1111 1.0E-26
sp|B2HSJ3|RPOB_MYCMM DNA-directed RNA polymerase subunit beta OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpoB PE=3 SV=1 657 1111 1.0E-26
sp|A1T4J2|RPOB_MYCVP DNA-directed RNA polymerase subunit beta OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=rpoB PE=3 SV=2 768 1111 1.0E-26
sp|Q9L637|RPOB_AMYMS DNA-directed RNA polymerase subunit beta OS=Amycolatopsis mediterranei (strain S699) GN=rpoB PE=3 SV=2 768 1109 1.0E-26
sp|A1SEK1|RPOB_NOCSJ DNA-directed RNA polymerase subunit beta OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rpoB PE=3 SV=1 743 1109 1.0E-26
sp|Q8F0S2|RPOB_LEPIN DNA-directed RNA polymerase subunit beta OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rpoB PE=3 SV=1 768 1109 1.0E-26
sp|Q72UA8|RPOB_LEPIC DNA-directed RNA polymerase subunit beta OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rpoB PE=3 SV=1 768 1109 1.0E-26
sp|B8IS78|RPOB_METNO DNA-directed RNA polymerase subunit beta OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpoB PE=3 SV=1 885 1109 2.0E-26
sp|A6KYK3|RPOB_BACV8 DNA-directed RNA polymerase subunit beta OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpoB PE=3 SV=1 861 1109 2.0E-26
sp|Q054E2|RPOB_LEPBL DNA-directed RNA polymerase subunit beta OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rpoB PE=3 SV=1 768 1109 2.0E-26
sp|Q04QI9|RPOB_LEPBJ DNA-directed RNA polymerase subunit beta OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rpoB PE=3 SV=1 768 1109 2.0E-26
sp|Q1J0P6|RPOB_DEIGD DNA-directed RNA polymerase subunit beta OS=Deinococcus geothermalis (strain DSM 11300) GN=rpoB PE=3 SV=1 768 1109 2.0E-26
sp|P30760|RPOB_MYCLE DNA-directed RNA polymerase subunit beta OS=Mycobacterium leprae (strain TN) GN=rpoB PE=3 SV=2 662 1111 2.0E-26
sp|B8ZSC7|RPOB_MYCLB DNA-directed RNA polymerase subunit beta OS=Mycobacterium leprae (strain Br4923) GN=rpoB PE=3 SV=1 662 1111 2.0E-26
sp|Q5YQP4|RPOB1_NOCFA DNA-directed RNA polymerase subunit beta 1 OS=Nocardia farcinica (strain IFM 10152) GN=rpoB1 PE=3 SV=1 681 1109 2.0E-26
sp|A5U052|RPOB_MYCTA DNA-directed RNA polymerase subunit beta OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rpoB PE=3 SV=2 768 1111 2.0E-26
sp|P9WGY9|RPOB_MYCTU DNA-directed RNA polymerase subunit beta OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpoB PE=1 SV=1 768 1111 2.0E-26
sp|P9WGY8|RPOB_MYCTO DNA-directed RNA polymerase subunit beta OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpoB PE=3 SV=1 768 1111 2.0E-26
sp|A1KGE7|RPOB_MYCBP DNA-directed RNA polymerase subunit beta OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rpoB PE=3 SV=2 768 1111 2.0E-26
sp|P0A681|RPOB_MYCBO DNA-directed RNA polymerase subunit beta OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rpoB PE=3 SV=1 768 1111 2.0E-26
sp|Q9F3X8|RPOB_PORCN DNA-directed RNA polymerase subunit beta OS=Porphyromonas cangingivalis GN=rpoB PE=3 SV=1 901 1109 2.0E-26
sp|Q134R8|RPOB_RHOPS DNA-directed RNA polymerase subunit beta OS=Rhodopseudomonas palustris (strain BisB5) GN=rpoB PE=3 SV=1 885 1109 2.0E-26
sp|Q9NJN5|RPOB_NEOCA DNA-directed RNA polymerase subunit beta OS=Neospora caninum GN=rpoB PE=3 SV=1 897 1109 2.0E-26
sp|A7IKQ0|RPOB_XANP2 DNA-directed RNA polymerase subunit beta OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpoB PE=3 SV=1 888 1109 2.0E-26
sp|B3QC00|RPOB_RHOPT DNA-directed RNA polymerase subunit beta OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpoB PE=3 SV=1 885 1109 2.0E-26
sp|Q6N4R9|RPOB_RHOPA DNA-directed RNA polymerase subunit beta OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpoB PE=3 SV=1 885 1109 2.0E-26
sp|Q8A469|RPOB_BACTN DNA-directed RNA polymerase subunit beta OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpoB PE=3 SV=1 861 1109 2.0E-26
sp|Q2IXS0|RPOB_RHOP2 DNA-directed RNA polymerase subunit beta OS=Rhodopseudomonas palustris (strain HaA2) GN=rpoB PE=3 SV=1 885 1109 3.0E-26
sp|Q06J17|RPOB_BIGNA DNA-directed RNA polymerase subunit beta OS=Bigelowiella natans GN=rpoB PE=3 SV=1 744 1113 3.0E-26
sp|A5FIJ3|RPOB_FLAJ1 DNA-directed RNA polymerase subunit beta OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=rpoB PE=3 SV=1 870 1109 3.0E-26
sp|P56869|RPOB_CHLMU DNA-directed RNA polymerase subunit beta OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpoB PE=3 SV=1 910 1109 3.0E-26
sp|A0T0D7|RPOB_PHATC DNA-directed RNA polymerase subunit beta OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rpoB PE=3 SV=1 768 1109 3.0E-26
sp|B0BBU6|RPOB_CHLTB DNA-directed RNA polymerase subunit beta OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rpoB PE=3 SV=1 910 1109 3.0E-26
sp|B0B7N1|RPOB_CHLT2 DNA-directed RNA polymerase subunit beta OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rpoB PE=3 SV=1 910 1109 3.0E-26
sp|P0CE09|RPOB_CHLTR DNA-directed RNA polymerase subunit beta OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpoB PE=3 SV=1 910 1109 3.0E-26
sp|Q3KM47|RPOB_CHLTA DNA-directed RNA polymerase subunit beta OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpoB PE=3 SV=1 910 1109 3.0E-26
sp|A1USC8|RPOB_BARBK DNA-directed RNA polymerase subunit beta OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpoB PE=3 SV=1 882 1109 4.0E-26
sp|Q5YPE0|RPOB2_NOCFA DNA-directed RNA polymerase subunit beta 2 OS=Nocardia farcinica (strain IFM 10152) GN=rpoB2 PE=3 SV=1 768 1109 4.0E-26
sp|A6YGE0|RPOB2_LEPTE DNA-directed RNA polymerase subunit beta C-terminal section OS=Leptosira terrestris GN=rpoB2 PE=3 SV=1 843 1109 4.0E-26
sp|A0M3Y9|RPOB_GRAFK DNA-directed RNA polymerase subunit beta OS=Gramella forsetii (strain KT0803) GN=rpoB PE=3 SV=1 901 1109 5.0E-26
sp|Q11HB3|RPOB_CHESB DNA-directed RNA polymerase subunit beta OS=Chelativorans sp. (strain BNC1) GN=rpoB PE=3 SV=1 886 1109 5.0E-26
sp|Q8WI24|RPOB_PSINU DNA-directed RNA polymerase subunit beta OS=Psilotum nudum GN=rpoB PE=3 SV=1 768 1113 5.0E-26
sp|A0LRL3|RPOB_ACIC1 DNA-directed RNA polymerase subunit beta OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rpoB PE=3 SV=1 739 1109 6.0E-26
sp|Q1QN44|RPOB_NITHX DNA-directed RNA polymerase subunit beta OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpoB PE=3 SV=1 885 1109 6.0E-26
sp|Q73SE4|RPOB_MYCPA DNA-directed RNA polymerase subunit beta OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rpoB PE=3 SV=2 768 1111 6.0E-26
sp|A0QL49|RPOB_MYCA1 DNA-directed RNA polymerase subunit beta OS=Mycobacterium avium (strain 104) GN=rpoB PE=3 SV=2 768 1111 6.0E-26
sp|P60283|RPOB_PHYPA DNA-directed RNA polymerase subunit beta OS=Physcomitrella patens subsp. patens GN=rpoB PE=3 SV=1 768 1153 7.0E-26
sp|Q64NJ7|RPOB_BACFR DNA-directed RNA polymerase subunit beta OS=Bacteroides fragilis (strain YCH46) GN=rpoB PE=3 SV=1 901 1109 7.0E-26
sp|Q5L897|RPOB_BACFN DNA-directed RNA polymerase subunit beta OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpoB PE=3 SV=1 901 1109 7.0E-26
sp|A9WSY0|RPOB_RENSM DNA-directed RNA polymerase subunit beta OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=rpoB PE=3 SV=1 768 1109 7.0E-26
sp|A5ELN7|RPOB_BRASB DNA-directed RNA polymerase subunit beta OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpoB PE=3 SV=1 885 1109 8.0E-26
sp|Q3SSY0|RPOB_NITWN DNA-directed RNA polymerase subunit beta OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpoB PE=3 SV=1 885 1109 8.0E-26
sp|A8LM40|RPOB_DINSH DNA-directed RNA polymerase subunit beta OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpoB PE=3 SV=1 910 1109 9.0E-26
sp|B7ICR3|RPOB_THEAB DNA-directed RNA polymerase subunit beta OS=Thermosipho africanus (strain TCF52B) GN=rpoB PE=3 SV=1 768 1109 9.0E-26
sp|C0ZVQ6|RPOB_RHOE4 DNA-directed RNA polymerase subunit beta OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=rpoB PE=3 SV=1 768 1109 9.0E-26
sp|A4YSI1|RPOB_BRASO DNA-directed RNA polymerase subunit beta OS=Bradyrhizobium sp. (strain ORS278) GN=rpoB PE=3 SV=1 885 1109 1.0E-25
sp|B1LY43|RPOB_METRJ DNA-directed RNA polymerase subunit beta OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpoB PE=3 SV=1 885 1109 1.0E-25
sp|Q89J74|RPOB_BRADU DNA-directed RNA polymerase subunit beta OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpoB PE=3 SV=1 885 1109 1.0E-25
sp|Q0SFB3|RPOB_RHOJR DNA-directed RNA polymerase subunit beta OS=Rhodococcus jostii (strain RHA1) GN=rpoB PE=3 SV=1 768 1109 1.0E-25
sp|C1AYV9|RPOB_RHOOB DNA-directed RNA polymerase subunit beta OS=Rhodococcus opacus (strain B4) GN=rpoB PE=3 SV=1 768 1109 1.0E-25
sp|Q211D8|RPOB_RHOPB DNA-directed RNA polymerase subunit beta OS=Rhodopseudomonas palustris (strain BisB18) GN=rpoB PE=3 SV=1 885 1109 1.0E-25
sp|Q28UX7|RPOB_JANSC DNA-directed RNA polymerase subunit beta OS=Jannaschia sp. (strain CCS1) GN=rpoB PE=3 SV=2 910 1109 1.0E-25
sp|B1VES1|RPOB_CORU7 DNA-directed RNA polymerase subunit beta OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=rpoB PE=3 SV=1 739 1109 2.0E-25
sp|Q1MPW8|RPOB_LAWIP DNA-directed RNA polymerase subunit beta OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rpoB PE=3 SV=1 910 1109 2.0E-25
sp|B8J1A8|RPOB_DESDA DNA-directed RNA polymerase subunit beta OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rpoB PE=3 SV=1 910 1109 2.0E-25
sp|A1A317|RPOB_BIFAA DNA-directed RNA polymerase subunit beta OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=rpoB PE=3 SV=2 768 1109 2.0E-25
sp|A1B015|RPOB_PARDP DNA-directed RNA polymerase subunit beta OS=Paracoccus denitrificans (strain Pd 1222) GN=rpoB PE=3 SV=1 910 1109 2.0E-25
sp|B8DLM7|RPOB_DESVM DNA-directed RNA polymerase subunit beta OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rpoB PE=3 SV=1 910 1109 2.0E-25
sp|Q8MA12|RPOB_CHAGL DNA-directed RNA polymerase subunit beta OS=Chaetosphaeridium globosum GN=rpoB PE=3 SV=1 768 1113 2.0E-25
sp|Q9KJG4|RPOB_BARHE DNA-directed RNA polymerase subunit beta OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpoB PE=3 SV=1 882 1109 2.0E-25
sp|A9ISG1|RPOB_BART1 DNA-directed RNA polymerase subunit beta OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpoB PE=3 SV=1 883 1109 2.0E-25
sp|B0UHX6|RPOB_METS4 DNA-directed RNA polymerase subunit beta OS=Methylobacterium sp. (strain 4-46) GN=rpoB PE=3 SV=1 885 1109 2.0E-25
sp|A8HTY8|RPOB_AZOC5 DNA-directed RNA polymerase subunit beta OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpoB PE=3 SV=1 885 1109 2.0E-25
sp|Q1MIE9|RPOB_RHIL3 DNA-directed RNA polymerase subunit beta OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpoB PE=3 SV=1 886 1109 2.0E-25
sp|Q54IZ9|RPC2_DICDI DNA-directed RNA polymerase III subunit rpc2 OS=Dictyostelium discoideum GN=polr3b PE=3 SV=1 112 542 2.0E-16
sp|Q753Q4|RPB2_ASHGO DNA-directed RNA polymerase II subunit RPB2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPB2 PE=3 SV=1 113 549 1.0E-13
sp|Q6GZR3|RPB2_FRG3G Putative DNA-directed RNA polymerase II subunit RPB2 homolog OS=Frog virus 3 (isolate Goorha) GN=FV3-062L PE=3 SV=1 696 824 1.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0005634 nucleus Yes
GO:0008152 metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0003676 nucleic acid binding No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043226 organelle No
GO:0097747 RNA polymerase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0005575 cellular_component No
GO:0044249 cellular biosynthetic process No
GO:0043227 membrane-bounded organelle No
GO:0140098 catalytic activity, acting on RNA No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044424 intracellular part No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0016779 nucleotidyltransferase activity No
GO:0003824 catalytic activity No
GO:0043229 intracellular organelle No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0044464 cell part No
GO:1901576 organic substance biosynthetic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6138
MPPSATDTRWDHEYHTLRREHLFRNPPADRSAYPALQEAVDPHIESFNALFRSDGKPGLVAHGLADIGTRIYFDG
DDRSDVNARNQLRIRIKDVALQRAQVPPSNKTARNREILPAECRERHVTYRGKLSATFEYTVNDGDPLEFVRELG
QVPIMVKSNRCYLENNSPALLVQRKEESEELGGYFIVNGIEKIIRLLQLNKRNFPMAINRPSFRNRGPEYTPFGI
IIRCVRPDETSQTNVLHYLSDGNMTFRFSWRKNEYLIPVMMILKALVETNDREIFEGVIGPMGCSSMENTFLADR
VELLLRTYKVYGLYGRSETRAYLGEKFRVVLGVPETMSDEEVGTEFMRRIVLVHLGNVDVTPEQDDAKFRLLLFM
IRKLFALADGKCAVDNPDAVQNQEVLLGGFLYGQILKERLDEFLSVNVRTSLREYFRRSPTVTFMSDDFRREFPA
AIFRKANENLGNSLEYFLSTGNLQSPSGLDLQQTAGFTVVAEKLNFLRFLSHFRMIHRGAFFAQLKTTTVRKLLP
ESWGFLCPVHTPDGAPCGLLNHLAHKCKIMTDAVDVSGLPALATEFGIVASSSASTDESVVVMLDGKILGWCRPK
ECRRIADCLRHWKVEGTHGVPLHLEIGYVPPSRGGTYPGVYLCSNPSRMVRPVKYLPLDKQDFVGPFEQPYMSIA
VVPHEIESGHSTHVELEPTNMLSILANMTPFSDFNQSPRNMYQCQMGKQTMGTPGAAIRYRTDNKSYRLQTGQTP
IVRAPLHNVYGFDNFPNGMNAVVAVISYTGYDMDDAMIINKSAHERGFGHGTVYKTKKITLKDDSRTKVAKSVTK
AFGFAPHSYVSGAYQGMLDDDGLPFIGRLVQEGDVLCAWHTVTPDYNGKLVNLDGVTHYEKYKESETGFVEEVRL
IGAETGTEPLQTISVKLRVPRSPVVGDKFSSRHGQKGVCSQKWPAVDLPFSESGMQPDVIINPHAFPSRMTIGMF
VESLAGKAGALHGLAQDSTPFRFDEQNTAADYFGHQLMKAGYNYHGNEPMYSGITGEELRADIYIGVVYYQRLRH
MVNDKFQVRTTGPVVPTTGQPIKGRKRGGGIRVGEMERDALLAHGTAFLLQDRLLNCSDYTRSWICRRCGSFLSV
QPTVSQLAPSKKGAPQLVRCRGCAVRLDEREGVDLTELQGEIWEDGQGVSWIGGEETTQVVVPGALRYLDVELAA
MGVKLRYRVSRHDEPRKGPMRPMAPPSAVAAAAPAAS*
Coding >Hirsu2|6138
ATGCCGCCCTCAGCGACCGATACACGATGGGATCACGAGTATCACACGCTTCGCCGCGAACATCTCTTTCGGAAT
CCCCCGGCCGACCGCAGCGCTTATCCCGCCCTCCAAGAGGCCGTCGACCCTCACATCGAATCCTTCAACGCCCTC
TTCCGCAGTGATGGCAAGCCGGGCCTGGTGGCCCATGGCCTCGCCGACATCGGCACCCGAATCTATTTCGACGGA
GACGACAGGTCAGACGTCAACGCCCGAAACCAACTCCGAATTCGCATCAAGGATGTCGCTCTGCAGAGGGCCCAA
GTGCCGCCTTCCAACAAGACGGCCCGCAACAGAGAGATTCTGCCGGCCGAGTGCAGAGAGCGGCACGTCACGTAC
AGGGGAAAGCTGTCGGCCACGTTCGAGTACACCGTCAATGACGGCGACCCGTTGGAGTTTGTGCGCGAGCTGGGG
CAGGTGCCCATCATGGTCAAGTCCAACCGATGCTATCTGGAAAACAACTCTCCCGCCTTGCTGGTGCAGCGCAAG
GAGGAGTCGGAGGAACTGGGAGGGTACTTCATCGTCAACGGCATTGAAAAAATCATCCGGCTGCTTCAGCTCAAC
AAGAGGAATTTCCCCATGGCCATCAACCGACCGAGCTTCAGGAACCGCGGACCGGAGTATACGCCCTTTGGCATC
ATCATCCGCTGCGTCCGGCCGGACGAGACATCGCAGACCAACGTGCTGCACTATCTGAGCGACGGAAACATGACG
TTCCGCTTCTCCTGGCGGAAAAACGAGTATCTCATCCCCGTCATGATGATCCTCAAGGCCCTGGTGGAGACCAAC
GATCGCGAGATATTCGAGGGCGTCATCGGGCCGATGGGCTGCAGCTCCATGGAAAACACCTTCCTCGCCGATCGA
GTCGAGCTGCTGTTGAGAACATACAAGGTCTACGGCCTCTACGGCAGGTCGGAGACGCGCGCATACCTGGGCGAA
AAGTTCCGAGTCGTCCTCGGCGTGCCGGAAACCATGTCGGACGAGGAAGTCGGCACCGAATTCATGCGGAGAATT
GTGCTGGTCCACCTCGGCAACGTCGACGTGACGCCGGAGCAGGATGACGCCAAGTTCCGCCTGCTCCTCTTCATG
ATCCGAAAGCTCTTCGCCTTGGCCGATGGCAAATGCGCCGTCGACAACCCCGACGCCGTCCAGAACCAGGAAGTC
TTGCTGGGCGGCTTTCTGTATGGCCAAATCCTCAAGGAGAGGCTGGACGAGTTCCTCAGCGTCAACGTCCGCACC
TCGCTGAGAGAGTACTTCCGCAGGAGCCCGACCGTCACCTTCATGTCCGACGACTTCCGACGCGAGTTCCCCGCC
GCCATCTTCCGGAAGGCCAACGAAAACCTTGGAAACTCGCTCGAGTACTTCTTGTCCACCGGCAATCTCCAGAGC
CCCTCGGGCCTCGACCTGCAGCAGACTGCCGGCTTCACGGTCGTGGCGGAGAAGCTCAACTTCCTGCGCTTCCTC
AGCCACTTCCGCATGATCCACCGCGGCGCCTTCTTCGCCCAGCTCAAGACGACGACGGTGCGAAAGCTGCTGCCG
GAGTCCTGGGGCTTCCTGTGCCCCGTCCACACGCCGGACGGCGCGCCCTGCGGCCTGCTCAACCATCTGGCCCAC
AAGTGCAAGATCATGACCGACGCGGTGGACGTCTCCGGGCTGCCGGCCCTGGCGACCGAGTTCGGCATCGTGGCC
TCGTCGTCGGCCTCGACGGACGAGAGCGTCGTGGTCATGCTGGACGGCAAGATCCTCGGCTGGTGTCGGCCCAAG
GAGTGCCGGCGCATCGCCGACTGCCTCCGGCACTGGAAGGTGGAGGGGACGCACGGCGTGCCGCTGCACCTGGAG
ATCGGCTACGTTCCGCCGTCGAGGGGCGGTACCTATCCCGGCGTCTACCTGTGCTCGAACCCGTCGAGGATGGTC
CGGCCGGTCAAGTATCTACCGCTGGACAAGCAGGACTTTGTTGGTCCGTTCGAGCAGCCGTACATGTCGATCGCG
GTGGTGCCGCACGAGATCGAGTCGGGCCATTCGACGCACGTCGAGCTGGAGCCGACCAACATGCTGTCGATCCTG
GCCAACATGACGCCCTTTTCCGACTTCAACCAGTCGCCGCGAAACATGTACCAGTGCCAGATGGGCAAGCAGACG
ATGGGGACGCCCGGGGCGGCGATCCGGTACCGGACGGACAACAAGTCGTACCGGCTGCAGACGGGGCAGACGCCG
ATCGTGCGGGCGCCGCTGCACAACGTGTACGGCTTCGACAACTTCCCCAACGGCATGAACGCCGTCGTGGCCGTC
ATCTCATACACGGGCTACGACATGGACGACGCCATGATCATCAACAAGTCGGCGCACGAGCGCGGCTTCGGCCAC
GGCACCGTCTACAAGACCAAGAAGATCACGCTCAAGGACGACTCGAGGACTAAGGTGGCCAAGAGCGTGACGAAG
GCGTTCGGCTTCGCGCCGCACAGCTACGTGAGCGGCGCCTACCAGGGCATGCTGGACGACGACGGGCTGCCGTTC
ATCGGGCGGCTGGTGCAGGAGGGCGACGTGCTCTGCGCCTGGCACACCGTGACGCCCGACTACAACGGGAAGCTG
GTGAACCTGGACGGCGTGACGCACTACGAGAAGTACAAGGAGTCGGAGACGGGCTTCGTGGAGGAGGTGCGGCTG
ATCGGGGCCGAGACGGGGACGGAGCCGCTGCAGACCATCTCGGTCAAGCTGCGGGTGCCGCGGTCGCCGGTCGTG
GGCGACAAGTTCTCGTCGCGGCACGGGCAGAAGGGCGTGTGCTCGCAGAAGTGGCCGGCGGTGGACCTTCCCTTC
TCCGAGTCCGGGATGCAGCCGGACGTCATCATCAACCCGCACGCGTTCCCGTCGCGCATGACGATCGGCATGTTC
GTCGAGTCGCTGGCGGGCAAGGCCGGGGCGCTGCACGGGCTGGCGCAGGACTCGACGCCGTTCCGGTTCGACGAG
CAGAACACGGCGGCCGACTACTTCGGGCACCAGCTGATGAAGGCCGGCTACAACTACCACGGCAACGAGCCCATG
TACTCGGGCATCACGGGCGAGGAGCTGAGGGCGGACATCTACATCGGCGTCGTCTACTACCAGCGGCTGCGGCAC
ATGGTCAACGACAAGTTCCAGGTGCGGACGACGGGGCCGGTGGTGCCGACGACGGGGCAGCCGATCAAGGGCCGC
AAGCGCGGCGGCGGCATCCGCGTGGGCGAGATGGAGCGCGACGCGCTGCTGGCGCACGGCACCGCCTTCCTGCTG
CAGGACCGGCTGCTCAACTGCTCCGACTACACGCGGTCGTGGATCTGCCGGCGGTGCGGCTCGTTCCTGTCGGTG
CAGCCGACGGTGTCGCAGCTGGCGCCGAGCAAGAAGGGGGCGCCGCAGCTGGTGCGGTGCCGCGGCTGCGCCGTG
CGGCTGGACGAGCGCGAGGGCGTCGACCTGACGGAGCTGCAGGGCGAGATCTGGGAGGACGGCCAGGGCGTGAGC
TGGATCGGGGGCGAAGAGACGACGCAGGTCGTGGTGCCGGGCGCGCTGCGGTACCTCGACGTCGAGCTGGCGGCC
ATGGGCGTCAAGCTGCGGTACCGGGTGAGCCGGCACGACGAGCCGCGCAAGGGGCCGATGCGGCCGATGGCGCCG
CCCAGTGCCGTTGCGGCAGCGGCGCCGGCGGCGTCGTGA
Transcript >Hirsu2|6138
ATGCCGCCCTCAGCGACCGATACACGATGGGATCACGAGTATCACACGCTTCGCCGCGAACATCTCTTTCGGAAT
CCCCCGGCCGACCGCAGCGCTTATCCCGCCCTCCAAGAGGCCGTCGACCCTCACATCGAATCCTTCAACGCCCTC
TTCCGCAGTGATGGCAAGCCGGGCCTGGTGGCCCATGGCCTCGCCGACATCGGCACCCGAATCTATTTCGACGGA
GACGACAGGTCAGACGTCAACGCCCGAAACCAACTCCGAATTCGCATCAAGGATGTCGCTCTGCAGAGGGCCCAA
GTGCCGCCTTCCAACAAGACGGCCCGCAACAGAGAGATTCTGCCGGCCGAGTGCAGAGAGCGGCACGTCACGTAC
AGGGGAAAGCTGTCGGCCACGTTCGAGTACACCGTCAATGACGGCGACCCGTTGGAGTTTGTGCGCGAGCTGGGG
CAGGTGCCCATCATGGTCAAGTCCAACCGATGCTATCTGGAAAACAACTCTCCCGCCTTGCTGGTGCAGCGCAAG
GAGGAGTCGGAGGAACTGGGAGGGTACTTCATCGTCAACGGCATTGAAAAAATCATCCGGCTGCTTCAGCTCAAC
AAGAGGAATTTCCCCATGGCCATCAACCGACCGAGCTTCAGGAACCGCGGACCGGAGTATACGCCCTTTGGCATC
ATCATCCGCTGCGTCCGGCCGGACGAGACATCGCAGACCAACGTGCTGCACTATCTGAGCGACGGAAACATGACG
TTCCGCTTCTCCTGGCGGAAAAACGAGTATCTCATCCCCGTCATGATGATCCTCAAGGCCCTGGTGGAGACCAAC
GATCGCGAGATATTCGAGGGCGTCATCGGGCCGATGGGCTGCAGCTCCATGGAAAACACCTTCCTCGCCGATCGA
GTCGAGCTGCTGTTGAGAACATACAAGGTCTACGGCCTCTACGGCAGGTCGGAGACGCGCGCATACCTGGGCGAA
AAGTTCCGAGTCGTCCTCGGCGTGCCGGAAACCATGTCGGACGAGGAAGTCGGCACCGAATTCATGCGGAGAATT
GTGCTGGTCCACCTCGGCAACGTCGACGTGACGCCGGAGCAGGATGACGCCAAGTTCCGCCTGCTCCTCTTCATG
ATCCGAAAGCTCTTCGCCTTGGCCGATGGCAAATGCGCCGTCGACAACCCCGACGCCGTCCAGAACCAGGAAGTC
TTGCTGGGCGGCTTTCTGTATGGCCAAATCCTCAAGGAGAGGCTGGACGAGTTCCTCAGCGTCAACGTCCGCACC
TCGCTGAGAGAGTACTTCCGCAGGAGCCCGACCGTCACCTTCATGTCCGACGACTTCCGACGCGAGTTCCCCGCC
GCCATCTTCCGGAAGGCCAACGAAAACCTTGGAAACTCGCTCGAGTACTTCTTGTCCACCGGCAATCTCCAGAGC
CCCTCGGGCCTCGACCTGCAGCAGACTGCCGGCTTCACGGTCGTGGCGGAGAAGCTCAACTTCCTGCGCTTCCTC
AGCCACTTCCGCATGATCCACCGCGGCGCCTTCTTCGCCCAGCTCAAGACGACGACGGTGCGAAAGCTGCTGCCG
GAGTCCTGGGGCTTCCTGTGCCCCGTCCACACGCCGGACGGCGCGCCCTGCGGCCTGCTCAACCATCTGGCCCAC
AAGTGCAAGATCATGACCGACGCGGTGGACGTCTCCGGGCTGCCGGCCCTGGCGACCGAGTTCGGCATCGTGGCC
TCGTCGTCGGCCTCGACGGACGAGAGCGTCGTGGTCATGCTGGACGGCAAGATCCTCGGCTGGTGTCGGCCCAAG
GAGTGCCGGCGCATCGCCGACTGCCTCCGGCACTGGAAGGTGGAGGGGACGCACGGCGTGCCGCTGCACCTGGAG
ATCGGCTACGTTCCGCCGTCGAGGGGCGGTACCTATCCCGGCGTCTACCTGTGCTCGAACCCGTCGAGGATGGTC
CGGCCGGTCAAGTATCTACCGCTGGACAAGCAGGACTTTGTTGGTCCGTTCGAGCAGCCGTACATGTCGATCGCG
GTGGTGCCGCACGAGATCGAGTCGGGCCATTCGACGCACGTCGAGCTGGAGCCGACCAACATGCTGTCGATCCTG
GCCAACATGACGCCCTTTTCCGACTTCAACCAGTCGCCGCGAAACATGTACCAGTGCCAGATGGGCAAGCAGACG
ATGGGGACGCCCGGGGCGGCGATCCGGTACCGGACGGACAACAAGTCGTACCGGCTGCAGACGGGGCAGACGCCG
ATCGTGCGGGCGCCGCTGCACAACGTGTACGGCTTCGACAACTTCCCCAACGGCATGAACGCCGTCGTGGCCGTC
ATCTCATACACGGGCTACGACATGGACGACGCCATGATCATCAACAAGTCGGCGCACGAGCGCGGCTTCGGCCAC
GGCACCGTCTACAAGACCAAGAAGATCACGCTCAAGGACGACTCGAGGACTAAGGTGGCCAAGAGCGTGACGAAG
GCGTTCGGCTTCGCGCCGCACAGCTACGTGAGCGGCGCCTACCAGGGCATGCTGGACGACGACGGGCTGCCGTTC
ATCGGGCGGCTGGTGCAGGAGGGCGACGTGCTCTGCGCCTGGCACACCGTGACGCCCGACTACAACGGGAAGCTG
GTGAACCTGGACGGCGTGACGCACTACGAGAAGTACAAGGAGTCGGAGACGGGCTTCGTGGAGGAGGTGCGGCTG
ATCGGGGCCGAGACGGGGACGGAGCCGCTGCAGACCATCTCGGTCAAGCTGCGGGTGCCGCGGTCGCCGGTCGTG
GGCGACAAGTTCTCGTCGCGGCACGGGCAGAAGGGCGTGTGCTCGCAGAAGTGGCCGGCGGTGGACCTTCCCTTC
TCCGAGTCCGGGATGCAGCCGGACGTCATCATCAACCCGCACGCGTTCCCGTCGCGCATGACGATCGGCATGTTC
GTCGAGTCGCTGGCGGGCAAGGCCGGGGCGCTGCACGGGCTGGCGCAGGACTCGACGCCGTTCCGGTTCGACGAG
CAGAACACGGCGGCCGACTACTTCGGGCACCAGCTGATGAAGGCCGGCTACAACTACCACGGCAACGAGCCCATG
TACTCGGGCATCACGGGCGAGGAGCTGAGGGCGGACATCTACATCGGCGTCGTCTACTACCAGCGGCTGCGGCAC
ATGGTCAACGACAAGTTCCAGGTGCGGACGACGGGGCCGGTGGTGCCGACGACGGGGCAGCCGATCAAGGGCCGC
AAGCGCGGCGGCGGCATCCGCGTGGGCGAGATGGAGCGCGACGCGCTGCTGGCGCACGGCACCGCCTTCCTGCTG
CAGGACCGGCTGCTCAACTGCTCCGACTACACGCGGTCGTGGATCTGCCGGCGGTGCGGCTCGTTCCTGTCGGTG
CAGCCGACGGTGTCGCAGCTGGCGCCGAGCAAGAAGGGGGCGCCGCAGCTGGTGCGGTGCCGCGGCTGCGCCGTG
CGGCTGGACGAGCGCGAGGGCGTCGACCTGACGGAGCTGCAGGGCGAGATCTGGGAGGACGGCCAGGGCGTGAGC
TGGATCGGGGGCGAAGAGACGACGCAGGTCGTGGTGCCGGGCGCGCTGCGGTACCTCGACGTCGAGCTGGCGGCC
ATGGGCGTCAAGCTGCGGTACCGGGTGAGCCGGCACGACGAGCCGCGCAAGGGGCCGATGCGGCCGATGGCGCCG
CCCAGTGCCGTTGCGGCAGCGGCGCCGGCGGCGTCGTGA
Gene >Hirsu2|6138
ATGCCGCCCTCAGCGACCGATACACGATGGGATCACGAGTATCACACGCTTCGCCGCGAACATCTCTTTCGGAAT
CCCCCGGCCGACCGCAGCGCTTATCCCGCCCTCCAAGAGGCCGTCGACCCTCACATCGAATCCTTCAACGCCCTC
TTCCGCAGTGATGGCAAGCCGGGCCTGGTGGCCCATGGCCTCGCCGACATCGGCACCCGAATCTATTTCGACGGA
GACGACAGGTCAGACGTCAACGCCCGAAACCAACTCCGAATTCGCATCAAGGATGTCGCTCTGCAGAGGGCCCAA
GTGCCGCCTTCCAACAAGACGGCCCGCAACAGAGAGATTCTGCCGGCCGAGTGCAGAGAGCGGCACGTCACGTAC
AGGGGAAAGCTGTCGGCCACGTTCGAGTACACCGTCAATGACGGCGACCCGTTGGAGTTTGTGCGCGAGCTGGGG
CAGGTGCCCATCATGGTCAAGGTATGGAGATATCGCGGGGGGGACGATAATAACAACAACCTGCTGACCTCGCTG
GATAGTCCAACCGATGCTATCTGGAAAACAACTCTCCCGCCTTGCTGGTGCAGCGCAAGGAGGAGTCGGAGGAAC
TGGGAGGGTACTTCATCGTCAACGGCATTGAAAAAATCATCCGGCTGCTTCAGCTCAACAAGAGGAATTTCCCCA
TGGCCATCAACCGACCGAGCTTCAGGAACCGCGGACCGGAGTATACGCCCTTTGGCATCATCATCCGCTGCGTCC
GGCCGGACGAGACATCGCAGACCAACGTGCTGCACTATCTGAGCGACGGAAACATGACGTTCCGCTTCTCCTGGC
GGAAAAACGAGTATCTCATCCCCGTCATGATGATCCTCAAGGCCCTGGTGGAGACCAACGATCGCGAGATATTCG
AGGGCGTCATCGGGCCGATGGGCTGCAGCTCCATGGAAAACACCTTCCTCGCCGATCGAGTCGAGCTGCTGTTGA
GAACATACAAGGTCTACGGCCTCTACGGCAGGTCGGAGACGCGCGCATACCTGGGCGAAAAGTTCCGAGTCGTCC
TCGGCGTGCCGGAAACCATGTCGGACGAGGAAGTCGGCACCGAATTCATGCGGAGAATTGTGCTGGTCCACCTCG
GCAACGTCGACGTGACGCCGGAGCAGGATGACGCCAAGTTCCGCCTGCTCCTCTTCATGATCCGAAAGCTCTTCG
CCTTGGCCGATGGCAAATGCGCCGTCGACAACCCCGACGCCGTCCAGAACCAGGAAGTCTTGCTGGGCGGCTTTC
TGTATGGCCAAATCCTCAAGGAGAGGCTGGACGAGTTCCTCAGCGTCAACGTCCGCACCTCGCTGAGAGAGTACT
TCCGCAGGAGCCCGACCGTCACCTTCATGTCCGACGACTTCCGACGCGAGTTCCCCGCCGCCATCTTCCGGAAGG
CCAACGAAAACCTTGGAAACTCGCTCGAGTACTTCTTGTCCACCGGCAATCTCCAGAGCCCCTCGGGCCTCGACC
TGCAGCAGACTGCCGGCTTCACGGTCGTGGCGGAGAAGCTCAACTTCCTGCGCTTCCTCAGCCACTTCCGCATGA
TCCACCGCGGCGCCTTCTTCGCCCAGCTCAAGACGACGACGGTGCGAAAGCTGCTGCCGGAGTCCTGGGGCTTCC
TGTGCCCCGTCCACACGCCGGACGGCGCGCCCTGCGGCCTGCTCAACCATCTGGCCCACAAGTGCAAGATCATGA
CCGACGCGGTGGACGTCTCCGGGCTGCCGGCCCTGGCGACCGAGTTCGGCATCGTGGCCTCGTCGTCGGCCTCGA
CGGACGAGAGCGTCGTGGTCATGCTGGACGGCAAGATCCTCGGCTGGTGTCGGCCCAAGGAGTGCCGGCGCATCG
CCGACTGCCTCCGGCACTGGAAGGTGGAGGGGACGCACGGCGTGCCGCTGCACCTGGAGATCGGCTACGTTCCGC
CGTCGAGGGGCGGTACCTATCCCGGCGTCTACCTGTGCTCGAACCCGTCGAGGATGGTCCGGCCGGTCAAGTATC
TACCGCTGGACAAGCAGGACTTTGTTGGTCCGTTCGAGCAGCCGTACATGTCGATCGCGGTGGTGCCGCACGAGA
TCGAGTCGGGCCATTCGACGCACGTCGAGCTGGAGCCGACCAACATGCTGTCGATCCTGGCCAACATGACGCCCT
TTTCCGACTTCAACCAGTCGCCGCGAAACATGTACCAGTGCCAGATGGGCAAGCAGACGATGGGGACGCCCGGGG
CGGCGATCCGGTACCGGACGGACAACAAGTCGTACCGGCTGCAGACGGGGCAGACGCCGATCGTGCGGGCGCCGC
TGCACAACGTGTACGGCTTCGACAACTTCCCCAACGGCATGAACGCCGTCGTGGCCGTCATCTCATACACGGGCT
ACGACATGGACGACGCCATGATCATCAACAAGTCGGCGCACGAGCGCGGCTTCGGCCACGGCACCGTCTACAAGA
CCAAGAAGATCACGCTCAAGGACGACTCGAGGACTAAGGTGGCCAAGAGCGTGACGAAGGCGTTCGGCTTCGCGC
CGCACAGCTACGTGAGCGGCGCCTACCAGGGCATGCTGGACGACGACGGGCTGCCGTTCATCGGGCGGCTGGTGC
AGGAGGGCGACGTGCTCTGCGCCTGGCACACCGTGACGCCCGACTACAACGGGAAGCTGGTGAACCTGGACGGCG
TGACGCACTACGAGAAGTACAAGGAGTCGGAGACGGGCTTCGTGGAGGAGGTGCGGCTGATCGGGGCCGAGACGG
GGACGGAGCCGCTGCAGACCATCTCGGTCAAGCTGCGGGTGCCGCGGTCGCCGGTCGTGGGCGACAAGTTCTCGT
CGCGGCACGGGCAGAAGGGCGTGTGCTCGCAGAAGTGGCCGGCGGTGGACCTTCCCTTCTCCGAGTCCGGGATGC
AGCCGGACGTCATCATCAACCCGCACGCGTTCCCGTCGCGCATGACGATCGGCATGTTCGTCGAGTCGCTGGCGG
GCAAGGCCGGGGCGCTGCACGGGCTGGCGCAGGACTCGACGCCGTTCCGGTTCGACGAGCAGAACACGGCGGCCG
ACTACTTCGGGCACCAGCTGATGAAGGCCGGCTACAACTACCACGGCAACGAGCCCATGTACTCGGGCATCACGG
GCGAGGAGCTGAGGGCGGACATCTACATCGGCGTCGTCTACTACCAGCGGCTGCGGCACATGGTCAACGACAAGT
TCCAGGTGCGGACGACGGGGCCGGTGGTGCCGACGACGGGGCAGCCGATCAAGGGCCGCAAGCGCGGCGGCGGCA
TCCGCGTGGGCGAGATGGAGCGCGACGCGCTGCTGGCGCACGGCACCGCCTTCCTGCTGCAGGACCGGCTGCTCA
ACTGCTCCGACTACACGCGGTCGTGGATCTGCCGGCGGTGCGGCTCGTTCCTGTCGGTGCAGCCGACGGTGTCGC
AGCTGGCGCCGAGCAAGAAGGGGGCGCCGCAGCTGGTGCGGTGCCGCGGCTGCGCCGTGCGGCTGGACGAGCGCG
AGGGCGTCGACCTGACGGAGCTGCAGGGCGAGATCTGGGAGGACGGCCAGGGCGTGAGCTGGATCGGGGGCGAAG
AGACGACGCAGGTCGTGGTGCCGGGCGCGCTGCGGTACCTCGACGTCGAGCTGGCGGCCATGGGCGTCAAGCTGC
GGTACCGGGTGAGCCGGCACGACGAGCCGCGCAAGGGGCCGATGCGGCCGATGGCGCCGCCCAGTGCCGTTGCGG
CAGCGGCGCCGGCGGCGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail