Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6128
Gene name
LocationContig_310:12276..15170
Strand-
Gene length (bp)2894
Transcript length (bp)2304
Coding sequence length (bp)2304
Protein length (aa) 768

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.0E-10 655 743
PF05729 NACHT NACHT domain 6.9E-09 173 286
PF00023 Ank Ankyrin repeat 8.1E-04 717 744
PF13637 Ank_4 Ankyrin repeats (many copies) 8.2E-05 689 736

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 612 743 3.0E-07
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 580 748 6.0E-06
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 568 749 8.0E-06
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 624 744 1.0E-05

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6128
MRVTAEFESSRRLVGDRCFGPRLTNFLHVVQQFAALGDIVVGGAQNLIACGVWSLVRMALLRSTWTQFALLLNNS
DVKTYQTQLKEWADLIKDEVRLIGLEEQREHSKVLFKLSKRQSHRQKQETKLRVLDACSKYEYQKTWIEIRKAGN
TTLFDQMPEYGNWKSQEKSCSLICRGRLGSGKSVLLANIVDDLHLRIHDAKRPVAYFFCRDDITESLKAHTIISS
LVRQLLSHVQDLTDAESYLDAAVPSLYFKSLRLILRHALPRDVKPYIVLDGLDECHEEDRRELIQQLKILQTDFA
FHICLSFRIGADDATRSGHHLFANCFTLTMPMGNPDIRRFIKAQLDQCLDCGSCGSLVIVEEEELTVRLVHQSVK
QFLFDPPSKFPATITKESAASLLADIVVTYLSYGVFETQLSTTLAPRVAGITVTSKVIDAISPSSSSRRLARKLL
MSWGRPGFDVGQALSEARSRLELPSAEHFGFYEYAKTNLIQHVWHFSEKPSSLGVMSAALLLKELDYHGTLVRRA
TEQGHGPEPLCKQHELLTLCEKVLRESAAIGIGCDINYLLAVLDGFTEITNTAAAIALDGQQRVQRILESKSGQL
VLDYLSRRKINSSQKAILLAVEKGHEKVLEVLLHTSNDYCLGRHGDGLWMPTTQAASISNVRQFVVRLLLNWAPA
SEPKRSSPRQMALPLAAEKGQEGITRLLLNCGAKVNTSDSAGRTALMYASQNGHEVIAKLLTMRGANIAKDRWNY
ARLHLRKMRRERLRQKR*
Coding >Hirsu2|6128
ATGCGTGTCACGGCCGAGTTCGAGTCCTCGCGCCGTCTTGTGGGCGACCGCTGCTTCGGGCCGCGTCTGACCAAC
TTCCTGCACGTTGTCCAGCAGTTTGCGGCTCTGGGAGATATCGTCGTCGGCGGCGCGCAGAATCTAATCGCGTGC
GGCGTCTGGTCGCTTGTGCGGATGGCTTTACTCAGGTCCACCTGGACCCAGTTTGCGCTGCTTTTGAACAACTCC
GACGTCAAGACCTATCAGACACAGCTCAAGGAATGGGCCGACTTGATCAAGGATGAAGTTCGGCTGATAGGGCTC
GAGGAGCAGCGCGAACACTCCAAAGTCCTGTTCAAGCTATCAAAACGCCAGTCGCACCGTCAGAAACAGGAAACC
AAGTTGCGCGTTCTTGACGCTTGCTCGAAGTACGAATACCAGAAAACTTGGATCGAAATCCGCAAGGCCGGGAAC
ACAACACTATTCGACCAGATGCCCGAGTACGGTAACTGGAAAAGCCAGGAGAAATCTTGCTCCTTGATATGCAGG
GGAAGGCTGGGATCCGGAAAGTCAGTGTTGCTCGCAAATATCGTGGACGATCTGCATCTCCGTATCCATGATGCC
AAGAGACCCGTCGCATATTTCTTCTGCCGTGACGACATTACCGAGAGCCTCAAGGCGCACACCATCATCTCTTCC
CTTGTCCGGCAACTCCTCAGTCATGTTCAAGACTTGACCGACGCTGAGAGTTATCTCGATGCTGCTGTGCCTAGT
CTCTATTTCAAGAGTCTGCGCCTTATACTGCGGCATGCCCTTCCGAGAGACGTTAAACCATACATCGTCTTGGAC
GGACTGGATGAATGCCATGAAGAAGATCGAAGGGAACTGATTCAGCAACTTAAAATACTCCAAACAGATTTCGCA
TTCCATATTTGCCTCTCGTTCAGGATAGGGGCAGATGATGCTACACGATCTGGTCACCATTTGTTTGCGAACTGC
TTTACTCTGACCATGCCGATGGGAAACCCAGATATTAGAAGATTTATCAAGGCTCAACTAGATCAGTGTCTGGAC
TGTGGTAGCTGTGGCAGTCTCGTCATTGTCGAGGAAGAAGAGCTCACGGTACGCCTAGTGCATCAGAGTGTTAAG
CAGTTCCTCTTCGACCCTCCAAGCAAGTTTCCTGCTACGATTACAAAGGAGAGCGCGGCCAGTCTCTTGGCGGAT
ATTGTTGTCACCTATCTGAGCTACGGCGTGTTCGAGACACAGCTGTCGACTACCCTGGCGCCCCGGGTGGCGGGC
ATCACAGTAACCTCCAAGGTCATAGATGCCATATCGCCTTCTTCTAGCTCCCGGAGACTTGCCCGGAAGCTATTG
ATGTCTTGGGGTCGGCCTGGCTTCGACGTGGGTCAGGCCCTCTCCGAAGCGAGGTCCCGACTGGAGCTCCCTTCT
GCAGAACATTTTGGCTTTTACGAATATGCCAAGACGAACTTGATACAGCACGTATGGCATTTCTCCGAGAAGCCG
TCTTCGCTGGGTGTTATGTCGGCCGCTCTCCTATTGAAAGAGCTTGACTACCACGGGACGCTGGTACGCCGAGCG
ACCGAACAAGGGCACGGACCAGAACCGCTCTGCAAGCAACATGAACTCTTGACTCTTTGCGAGAAAGTCTTGAGG
GAAAGTGCAGCTATAGGGATTGGTTGCGATATCAACTACCTCCTTGCGGTGCTTGACGGCTTCACGGAGATAACT
AACACAGCTGCAGCAATCGCACTTGATGGGCAGCAGCGCGTGCAGAGAATCTTGGAGTCTAAGTCGGGCCAGTTA
GTCTTGGATTACTTGTCCAGACGAAAGATCAATTCCTCGCAGAAAGCAATATTACTTGCCGTGGAAAAGGGGCAT
GAGAAAGTTCTTGAAGTCCTCCTCCACACCTCCAATGACTACTGCTTAGGGCGACATGGAGACGGGCTTTGGATG
CCGACGACGCAGGCGGCCAGCATCTCCAATGTACGCCAGTTCGTTGTGAGGCTCCTGCTCAACTGGGCTCCTGCT
TCAGAACCGAAGAGATCTAGTCCTCGGCAGATGGCACTACCATTGGCAGCAGAGAAAGGACAAGAGGGAATTACC
CGTCTACTCCTTAACTGCGGTGCTAAAGTAAACACCAGCGACTCCGCTGGGCGCACGGCGCTCATGTACGCGTCT
CAGAATGGGCACGAGGTCATCGCGAAGCTCCTAACAATGAGGGGTGCAAACATAGCTAAGGATAGGTGGAACTAC
GCCAGACTTCATCTACGAAAAATGAGACGAGAAAGGCTGAGACAAAAACGCTGA
Transcript >Hirsu2|6128
ATGCGTGTCACGGCCGAGTTCGAGTCCTCGCGCCGTCTTGTGGGCGACCGCTGCTTCGGGCCGCGTCTGACCAAC
TTCCTGCACGTTGTCCAGCAGTTTGCGGCTCTGGGAGATATCGTCGTCGGCGGCGCGCAGAATCTAATCGCGTGC
GGCGTCTGGTCGCTTGTGCGGATGGCTTTACTCAGGTCCACCTGGACCCAGTTTGCGCTGCTTTTGAACAACTCC
GACGTCAAGACCTATCAGACACAGCTCAAGGAATGGGCCGACTTGATCAAGGATGAAGTTCGGCTGATAGGGCTC
GAGGAGCAGCGCGAACACTCCAAAGTCCTGTTCAAGCTATCAAAACGCCAGTCGCACCGTCAGAAACAGGAAACC
AAGTTGCGCGTTCTTGACGCTTGCTCGAAGTACGAATACCAGAAAACTTGGATCGAAATCCGCAAGGCCGGGAAC
ACAACACTATTCGACCAGATGCCCGAGTACGGTAACTGGAAAAGCCAGGAGAAATCTTGCTCCTTGATATGCAGG
GGAAGGCTGGGATCCGGAAAGTCAGTGTTGCTCGCAAATATCGTGGACGATCTGCATCTCCGTATCCATGATGCC
AAGAGACCCGTCGCATATTTCTTCTGCCGTGACGACATTACCGAGAGCCTCAAGGCGCACACCATCATCTCTTCC
CTTGTCCGGCAACTCCTCAGTCATGTTCAAGACTTGACCGACGCTGAGAGTTATCTCGATGCTGCTGTGCCTAGT
CTCTATTTCAAGAGTCTGCGCCTTATACTGCGGCATGCCCTTCCGAGAGACGTTAAACCATACATCGTCTTGGAC
GGACTGGATGAATGCCATGAAGAAGATCGAAGGGAACTGATTCAGCAACTTAAAATACTCCAAACAGATTTCGCA
TTCCATATTTGCCTCTCGTTCAGGATAGGGGCAGATGATGCTACACGATCTGGTCACCATTTGTTTGCGAACTGC
TTTACTCTGACCATGCCGATGGGAAACCCAGATATTAGAAGATTTATCAAGGCTCAACTAGATCAGTGTCTGGAC
TGTGGTAGCTGTGGCAGTCTCGTCATTGTCGAGGAAGAAGAGCTCACGGTACGCCTAGTGCATCAGAGTGTTAAG
CAGTTCCTCTTCGACCCTCCAAGCAAGTTTCCTGCTACGATTACAAAGGAGAGCGCGGCCAGTCTCTTGGCGGAT
ATTGTTGTCACCTATCTGAGCTACGGCGTGTTCGAGACACAGCTGTCGACTACCCTGGCGCCCCGGGTGGCGGGC
ATCACAGTAACCTCCAAGGTCATAGATGCCATATCGCCTTCTTCTAGCTCCCGGAGACTTGCCCGGAAGCTATTG
ATGTCTTGGGGTCGGCCTGGCTTCGACGTGGGTCAGGCCCTCTCCGAAGCGAGGTCCCGACTGGAGCTCCCTTCT
GCAGAACATTTTGGCTTTTACGAATATGCCAAGACGAACTTGATACAGCACGTATGGCATTTCTCCGAGAAGCCG
TCTTCGCTGGGTGTTATGTCGGCCGCTCTCCTATTGAAAGAGCTTGACTACCACGGGACGCTGGTACGCCGAGCG
ACCGAACAAGGGCACGGACCAGAACCGCTCTGCAAGCAACATGAACTCTTGACTCTTTGCGAGAAAGTCTTGAGG
GAAAGTGCAGCTATAGGGATTGGTTGCGATATCAACTACCTCCTTGCGGTGCTTGACGGCTTCACGGAGATAACT
AACACAGCTGCAGCAATCGCACTTGATGGGCAGCAGCGCGTGCAGAGAATCTTGGAGTCTAAGTCGGGCCAGTTA
GTCTTGGATTACTTGTCCAGACGAAAGATCAATTCCTCGCAGAAAGCAATATTACTTGCCGTGGAAAAGGGGCAT
GAGAAAGTTCTTGAAGTCCTCCTCCACACCTCCAATGACTACTGCTTAGGGCGACATGGAGACGGGCTTTGGATG
CCGACGACGCAGGCGGCCAGCATCTCCAATGTACGCCAGTTCGTTGTGAGGCTCCTGCTCAACTGGGCTCCTGCT
TCAGAACCGAAGAGATCTAGTCCTCGGCAGATGGCACTACCATTGGCAGCAGAGAAAGGACAAGAGGGAATTACC
CGTCTACTCCTTAACTGCGGTGCTAAAGTAAACACCAGCGACTCCGCTGGGCGCACGGCGCTCATGTACGCGTCT
CAGAATGGGCACGAGGTCATCGCGAAGCTCCTAACAATGAGGGGTGCAAACATAGCTAAGGATAGGTGGAACTAC
GCCAGACTTCATCTACGAAAAATGAGACGAGAAAGGCTGAGACAAAAACGCTGA
Gene >Hirsu2|6128
ATGCGTGTCACGGCCGAGTTCGAGTCCTCGCGCCGTCTTGTGGGCGACCGCTGCTTCGGGCCGCGTCTGACCAAC
TTCCTGCACGTTGTCCAGCAGTTTGCGGCTCTGGGAGATATCGTCGTCGGCGGCGCGCAGAATCTAATCGCGTGC
GGCGTCTGGTCGCTTGTGCGGATGGCTTTACTCGTGCGTCATCCACCTGTTGCAGACGAGCGTCTTATCTTTTGC
TTAACCTCGTGACCTTTGAATCCAGCCTTGACAACCTGACGGCATTTTTCATGCACATCGGCCGATCGGCTCCCA
GCTTCAAGAGAATGGCGCTTCTCTATCCTTGCTCTCCAGCGCTGCAATCCCATCTGTCCGAGTATTTCACAGTTG
TGGTTCAAATTTGCCATCACCTCTTAAAAGTGAGCAAGAGGTCCACCTGGACCCAGTTTGCGCTGCTTTTGAACA
ACTCCGACGTCAAGACCTATCAGACACAGCTCAAGGAATGGGCCGACTTGATCAAGGATGAAGTTCGGCTGATAG
GGCTCGAGGAGCAGCGCGAACACTCCAAAGTCCTGTTCAAGCTATCAAAACGCCAGTCGCACCGTCAGAAACAGG
AAACCAAGTTGCGCGTTCTTGACGCTTGCTCGAAGTACGAATACCAGAAAACTTGGATCGAAATCCGCAAGGCCG
GGAACACAACACTATTCGACCAGATGCCCGAGTACGGTAACTGGAAAAGCCAGGAGAAATCTTGCTCCTTGATAT
GCAGGGGAAGGCTGGGATCCGGAAAGTCAGTGTTGCTCGCAAATATCGTGGACGATCTGCATCTCCGTATCCATG
ATGCCAAGAGACCCGTCGCATATTTCTTCTGCCGTGACGACATTACCGAGAGCCTCAAGGCGCACACCATCATCT
CTTCCCTTGTCCGGCAACTCCTCAGTCATGTTCAAGACTTGACCGACGCTGAGAGTTATCTCGATGCTGCTGTGC
CTAGTCTCTATTTCAAGAGTCTGCGCCTTATACTGCGGCATGCCCTTCCGAGAGACGTTAAACCATACATCGTCT
TGGACGGACTGGATGAATGCCATGAAGAAGATCGAAGGGAACTGATTCAGCAACTTAAAATACTCCAAACAGATT
TCGCATTCCATATTTGCCTCTCGTTCAGGATAGGGGCAGATGATGCTACACGATCTGGTCACCATTTGTTTGCGA
ACTGCTTTACTCTGACCATGCCGATGGGAAACCCAGATATTAGAAGATTTATCAAGGCTCAACTAGATCAGTGTC
TGGACTGTGGTAGGTTAGAGATCGGAGACCCGGGGCTAATTCTCGATATATACGAGGCTCTGCTACAAGGAGCCC
AAGGAATGTTCCTCTGGGTTGCACTCCAGATCGAATCCCTCTGCGCCGCAAAGACAGACGAGACGCTTCGATAAG
CGTTGAAGAATCTCCCCAAGGATCTGCCAGAAACTTATGCTCGCATCTTACGAAAGTCGGACGAACTTGGTGGGG
ACTACCAGAAGCGCATCTTAAAGCTGATAACTGCAGCCCACCGGCCCCTAACAATAGATGAGCTACGAGAGGCCC
TGAGCGTCATCCCGGGGGATACGACGTGGAATCCGGCTCGAATTTTAAACAATATATACACCACGCTCTCTAGCT
GTGGCAGTCTCGTCATTGTCGAGGAAGAAGAGCTCACGGTACGCCTAGTGCATCAGAGTGTTAAGCAGTTCCTCT
TCGACCCTCCAAGCAAGTTTCCTGCTACGATTACAAAGGAGAGCGCGGCCAGTCTCTTGGCGGATATTGTTGTCA
CCTATCTGAGCTACGGCGTGTTCGAGACACAGCTGTCGACTACCCTGGCGCCCCGGGTGGCGGGCATCACAGTAA
CCTCCAAGGTCATAGATGCCATATCGCCTTCTTCTAGCTCCCGGAGACTTGCCCGGAAGCTATTGATGTCTTGGG
GTCGGCCTGGCTTCGACGTGGGTCAGGCCCTCTCCGAAGCGAGGTCCCGACTGGAGCTCCCTTCTGCAGAACATT
TTGGCTTTTACGAATATGCCAAGACGAACTTGATACAGCACGTATGGCATTTCTCCGAGAAGCCGTCTTCGCTGG
GTGTTATGTCGGCCGCTCTCCTATTGAAAGAGCTTGACTACCACGGGACGCTGGTACGCCGAGCGACCGAACAAG
GGCACGGACCAGAACCGCTCTGCAAGCAACATGAACTCTTGACTCTTTGCGAGAAAGTCTTGAGGGAAAGTGCAG
CTATAGGGATTGGTTGCGATATCAACTACCTCCTTGCGGTGCTTGACGGCTTCACGGAGATAACTAACACAGCTG
CAGCAATCGCACTTGATGGGCAGCAGCGCGTGCAGAGAATCTTGGAGTCTAAGTCGGGCCAGTTAGTCTTGGATT
ACTTGTCCAGACGAAAGATCAATTCCTCGCAGAAAGCAATATTACTTGCCGTGGAAAAGGGGCATGAGAAAGTTC
TTGAAGTCCTCCTCCACACCTCCAATGACTACTGCTTAGGGCGACATGGAGACGGGCTTTGGATGCCGACGACGC
AGGCGGCCAGCATCTCCAATGTACGCCAGTTCGTTGTGAGGCTCCTGCTCAACTGGGCTCCTGCTTCAGAACCGA
AGAGATCTAGTCCTCGGCAGATGGCACTACCATTGGCAGCAGAGAAAGGACAAGAGGGAATTACCCGTCTACTCC
TTAACTGCGGTGCTAAAGTAAACACCAGCGACTCCGCTGGGCGCACGGCGCTCATGTACGCGTCTCAGAATGGGC
ACGAGGTCATCGCGAAGCTCCTAACAATGAGGGGTGCAAACATAGCTAAGGATAGGTGGAACTACGCCAGACTTC
ATCTACGAAAAATGAGACGAGAAAGGCTGAGACAAAAACGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail