Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6124
Gene name
LocationContig_310:387..1970
Strand+
Gene length (bp)1583
Transcript length (bp)1404
Coding sequence length (bp)1404
Protein length (aa) 468

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 6.9E-07 314 349
PF00890 FAD_binding_2 FAD binding domain 2.1E-06 13 43

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 12 381 6.0E-21
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 32 384 4.0E-15
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 114 413 4.0E-13
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 114 413 5.0E-13
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 159 384 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 12 381 6.0E-21
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 32 384 4.0E-15
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 114 413 4.0E-13
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 114 413 5.0E-13
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 159 384 3.0E-12
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 2 373 1.0E-11
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 1 416 6.0E-10
sp|Q0JCU7|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1 13 378 8.0E-09
sp|Q0QFQ1|3HBH2_PSEAC 3-hydroxybenzoate 6-hydroxylase 2 OS=Pseudomonas alcaligenes GN=hbzD PE=2 SV=1 114 384 2.0E-08
sp|C3VEQ2|ZEP_ONCHC Zeaxanthin epoxidase, chloroplastic OS=Oncidium hybrid cultivar GN=ZEP PE=2 SV=1 126 378 3.0E-08
sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 29 416 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0050662 coenzyme binding No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6124
MASAPTASAALHVLIVGAGFGGLTAAIECRLRGMRVTLVEAYPTSAAYGDIIDFFPNGGRIIEKWEGGRVGRELM
GVCISQGDQLRYCKADGTVIWEEPWVLEPHHYWRQFGGHRGQMHAVILRYARELGVELAFGDRAVRYLGAGPGAA
RPGVVLAGGAELAADVVIAADGPRSIARQQVLGLPDNKVNSGYAIFRAHLSLTDEHRANPLLADFCDPASDMTQL
WVARDLHMIVYTWNKGRELGWALTHKDTDDIGESWSFPAHKDDVLACLAQGGFEPKLAELVRATPAAKMVDYKLV
WREPLATWLAPSARIALIGDAAHCHLPTSAQGGSQAMEDGVALAVCLARAAGDVPLALRVFERVRFNRSHVIHMA
SILIRDGYHNIDWDGDDIKKNPQILNLPRPAWVIEHDVEAEAESHFDRLAADVRAGTPGSLAELSIPAGGDYEPE
SRRVGQPRQEEAAAAGP*
Coding >Hirsu2|6124
ATGGCATCGGCTCCCACGGCTTCTGCCGCGCTGCACGTGCTCATCGTCGGGGCCGGCTTCGGCGGGCTGACGGCG
GCGATCGAGTGCCGGCTGCGCGGGATGCGGGTGACGCTGGTGGAGGCGTACCCGACCAGCGCCGCCTACGGCGAC
ATCATCGACTTCTTCCCCAACGGCGGGCGCATCATCGAGAAGTGGGAGGGCGGCCGGGTCGGGCGCGAGCTGATG
GGCGTGTGCATCAGCCAGGGCGACCAGCTGCGCTACTGCAAGGCCGACGGCACCGTCATCTGGGAGGAGCCTTGG
GTGCTGGAGCCGCACCACTACTGGCGCCAGTTCGGCGGCCACCGCGGCCAGATGCACGCTGTCATCCTGCGCTAC
GCGCGCGAGCTCGGCGTCGAGCTGGCCTTTGGCGACCGCGCCGTCCGCTACCTCGGCGCCGGCCCCGGCGCCGCC
CGGCCCGGCGTCGTCCTGGCCGGTGGGGCCGAGCTGGCGGCCGATGTCGTCATCGCCGCCGACGGGCCGCGCTCC
ATCGCCCGCCAGCAGGTGCTCGGCCTGCCCGACAACAAGGTCAACAGCGGCTACGCCATCTTCCGCGCCCACCTG
AGCCTGACGGACGAGCACCGCGCCAACCCGCTGCTGGCCGACTTCTGCGACCCGGCCTCGGACATGACCCAGCTC
TGGGTCGCCCGCGACCTGCACATGATCGTCTACACCTGGAACAAGGGCCGCGAGCTCGGCTGGGCCCTGACGCAC
AAGGACACCGACGACATCGGCGAGTCGTGGTCGTTCCCCGCCCACAAGGACGACGTGCTCGCCTGCCTGGCCCAG
GGCGGCTTCGAGCCCAAGCTGGCGGAGCTGGTCCGGGCCACGCCGGCGGCCAAGATGGTCGACTACAAGCTCGTC
TGGCGCGAGCCGCTGGCGACCTGGCTGGCGCCCTCGGCCCGCATCGCCCTCATCGGCGACGCCGCCCACTGCCAC
CTGCCGACCTCGGCCCAGGGCGGCTCGCAGGCCATGGAGGACGGCGTGGCGCTGGCCGTGTGCCTGGCCCGCGCC
GCCGGCGACGTGCCGCTGGCCCTGCGCGTCTTCGAGCGCGTCCGCTTCAACCGGTCCCACGTCATCCACATGGCC
TCCATCCTCATCCGCGACGGCTACCACAACATCGACTGGGACGGCGACGACATCAAGAAGAACCCGCAGATCCTC
AACCTGCCCCGGCCCGCCTGGGTCATCGAGCACGACGTCGAGGCCGAGGCCGAGTCCCACTTCGACCGCCTCGCC
GCCGACGTCCGCGCCGGCACGCCGGGCTCCCTCGCCGAGCTGTCCATCCCCGCCGGCGGCGATTACGAGCCGGAG
AGCCGACGGGTTGGCCAGCCGCGACAGGAGGAGGCCGCCGCCGCCGGCCCTTGA
Transcript >Hirsu2|6124
ATGGCATCGGCTCCCACGGCTTCTGCCGCGCTGCACGTGCTCATCGTCGGGGCCGGCTTCGGCGGGCTGACGGCG
GCGATCGAGTGCCGGCTGCGCGGGATGCGGGTGACGCTGGTGGAGGCGTACCCGACCAGCGCCGCCTACGGCGAC
ATCATCGACTTCTTCCCCAACGGCGGGCGCATCATCGAGAAGTGGGAGGGCGGCCGGGTCGGGCGCGAGCTGATG
GGCGTGTGCATCAGCCAGGGCGACCAGCTGCGCTACTGCAAGGCCGACGGCACCGTCATCTGGGAGGAGCCTTGG
GTGCTGGAGCCGCACCACTACTGGCGCCAGTTCGGCGGCCACCGCGGCCAGATGCACGCTGTCATCCTGCGCTAC
GCGCGCGAGCTCGGCGTCGAGCTGGCCTTTGGCGACCGCGCCGTCCGCTACCTCGGCGCCGGCCCCGGCGCCGCC
CGGCCCGGCGTCGTCCTGGCCGGTGGGGCCGAGCTGGCGGCCGATGTCGTCATCGCCGCCGACGGGCCGCGCTCC
ATCGCCCGCCAGCAGGTGCTCGGCCTGCCCGACAACAAGGTCAACAGCGGCTACGCCATCTTCCGCGCCCACCTG
AGCCTGACGGACGAGCACCGCGCCAACCCGCTGCTGGCCGACTTCTGCGACCCGGCCTCGGACATGACCCAGCTC
TGGGTCGCCCGCGACCTGCACATGATCGTCTACACCTGGAACAAGGGCCGCGAGCTCGGCTGGGCCCTGACGCAC
AAGGACACCGACGACATCGGCGAGTCGTGGTCGTTCCCCGCCCACAAGGACGACGTGCTCGCCTGCCTGGCCCAG
GGCGGCTTCGAGCCCAAGCTGGCGGAGCTGGTCCGGGCCACGCCGGCGGCCAAGATGGTCGACTACAAGCTCGTC
TGGCGCGAGCCGCTGGCGACCTGGCTGGCGCCCTCGGCCCGCATCGCCCTCATCGGCGACGCCGCCCACTGCCAC
CTGCCGACCTCGGCCCAGGGCGGCTCGCAGGCCATGGAGGACGGCGTGGCGCTGGCCGTGTGCCTGGCCCGCGCC
GCCGGCGACGTGCCGCTGGCCCTGCGCGTCTTCGAGCGCGTCCGCTTCAACCGGTCCCACGTCATCCACATGGCC
TCCATCCTCATCCGCGACGGCTACCACAACATCGACTGGGACGGCGACGACATCAAGAAGAACCCGCAGATCCTC
AACCTGCCCCGGCCCGCCTGGGTCATCGAGCACGACGTCGAGGCCGAGGCCGAGTCCCACTTCGACCGCCTCGCC
GCCGACGTCCGCGCCGGCACGCCGGGCTCCCTCGCCGAGCTGTCCATCCCCGCCGGCGGCGATTACGAGCCGGAG
AGCCGACGGGTTGGCCAGCCGCGACAGGAGGAGGCCGCCGCCGCCGGCCCTTGA
Gene >Hirsu2|6124
ATGGCATCGGCTCCCACGGCTTCTGCCGCGCTGCACGTGCTCATCGTCGGGGCCGGCTTCGGCGGGCTGACGGCG
GCGATCGAGTGCCGGCTGCGCGGGATGCGGGTGACGCTGGTGGAGGCGTACCCGACCAGCGCCGCCTACGGCGAC
ATCATCGACTTCTTCCCCAACGGCGGGCGCATCATCGAGAAGTGGGAGGGCGGCCGGGTCGGGCGCGAGCTGATG
GGCGTGTGCATCAGCCAGGGCGACCAGCTGCGCTACTGCAAGGCCGACGGCACCGTCATCTGGGAGGAGCCTTGG
GTGCTGGAGCCGCACCACTACTGGCGCCAGTTCGGCGGCCACCGCGGCCAGATGCACGCTGTCATCCTGCGCTAC
GCGCGCGAGCTCGGCGTCGAGCTGGCCTTTGGCGACCGCGCCGTCCGCTACCTCGGCGCCGGCCCCGGCGCCGCC
CGGCCCGGCGTCGTCCTGGCCGGTGGGGCCGAGCTGGCGGCCGATGTCGTCATCGCCGCCGACGGGCCGCGCTCC
ATCGCCCGCCAGCAGGTGCTCGGCCTGCCCGACAACAAGGTCAACAGCGGCTACGCCATCTTCCGCGCCCACCTG
AGCCTGACGGACGAGCACCGCGCCAACCCGCTGCTGGCCGACTTCTGCGACCCGGCCTCGGACATGACCCAGCTC
TGGGTCGCCCGCGACCTGCACATGATCGTCTACACCTGGAACAAGGGCCGCGAGCTCGGCTGGGCCCTGACGCAC
AAGGTTGGCCTCTCTGTCTCTCTGTCTCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNCTCTCTCTCTGTGTGTGTGTCCGTCGTTGCTGTTGTCGTTTCTCGCTGGCTTGGCTCACC
GGACACTGACGATGCCGGAACCCGTGCCGCAGGACACCGACGACATCGGCGAGTCGTGGTCGTTCCCCGCCCACA
AGGACGACGTGCTCGCCTGCCTGGCCCAGGGCGGCTTCGAGCCCAAGCTGGCGGAGCTGGTCCGGGCCACGCCGG
CGGCCAAGATGGTCGACTACAAGCTCGTCTGGCGCGAGCCGCTGGCGACCTGGCTGGCGCCCTCGGCCCGCATCG
CCCTCATCGGCGACGCCGCCCACTGCCACCTGCCGACCTCGGCCCAGGGCGGCTCGCAGGCCATGGAGGACGGCG
TGGCGCTGGCCGTGTGCCTGGCCCGCGCCGCCGGCGACGTGCCGCTGGCCCTGCGCGTCTTCGAGCGCGTCCGCT
TCAACCGGTCCCACGTCATCCACATGGCCTCCATCCTCATCCGCGACGGCTACCACAACATCGACTGGGACGGCG
ACGACATCAAGAAGAACCCGCAGATCCTCAACCTGCCCCGGCCCGCCTGGGTCATCGAGCACGACGTCGAGGCCG
AGGCCGAGTCCCACTTCGACCGCCTCGCCGCCGACGTCCGCGCCGGCACGCCGGGCTCCCTCGCCGAGCTGTCCA
TCCCCGCCGGCGGCGATTACGAGCCGGAGAGCCGACGGGTTGGCCAGCCGCGACAGGAGGAGGCCGCCGCCGCCG
GCCCTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail