Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6121
Gene name
LocationContig_31:49898..50413
Strand-
Gene length (bp)515
Transcript length (bp)336
Coding sequence length (bp)336
Protein length (aa) 112

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|C7FF04|PPO3_AGABI Polyphenol oxidase 3 OS=Agaricus bisporus GN=PPO3 PE=1 SV=1 29 106 5.0E-08
sp|Q8J130|TYRO_ASPFU Tyrosinase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tyr1 PE=3 SV=2 23 107 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6121
MMLPNVVALNLVFGTALVVVAQNSGRPFPVVGVQSSRSVRRNVNDLFDERGPEWDLYVQALSAMQDADSDDPLSW
FQIGAIHGQPRIEWNNTGRGIPGNDAGYCTHSFSRC*
Coding >Hirsu2|6121
ATGATGCTCCCCAACGTGGTAGCCTTGAACCTGGTGTTCGGGACGGCCTTGGTGGTCGTGGCCCAGAACTCTGGC
CGTCCCTTCCCCGTCGTCGGCGTCCAGTCCAGCCGGAGCGTCAGGCGCAACGTCAACGACCTCTTTGACGAGAGG
GGGCCGGAATGGGACCTCTACGTGCAGGCGCTCAGTGCCATGCAGGATGCCGACTCGGACGATCCCCTGTCGTGG
TTCCAAATCGGAGCGATCCACGGCCAGCCGCGCATCGAGTGGAACAACACTGGCCGTGGAATTCCTGGCAATGAT
GCAGGCTATTGTACTCATAGCTTCTCGAGGTGTTGA
Transcript >Hirsu2|6121
ATGATGCTCCCCAACGTGGTAGCCTTGAACCTGGTGTTCGGGACGGCCTTGGTGGTCGTGGCCCAGAACTCTGGC
CGTCCCTTCCCCGTCGTCGGCGTCCAGTCCAGCCGGAGCGTCAGGCGCAACGTCAACGACCTCTTTGACGAGAGG
GGGCCGGAATGGGACCTCTACGTGCAGGCGCTCAGTGCCATGCAGGATGCCGACTCGGACGATCCCCTGTCGTGG
TTCCAAATCGGAGCGATCCACGGCCAGCCGCGCATCGAGTGGAACAACACTGGCCGTGGAATTCCTGGCAATGAT
GCAGGCTATTGTACTCATAGCTTCTCGAGGTGTTGA
Gene >Hirsu2|6121
ATGATGCTCCCCAACGTGGTAGCCTTGAACCTGGTGTTCGGGACGGCCTTGGTGGTCGTGGCCCAGAACTCTGGC
CGTCCCTTCCCCGTCGTCGGCGTCCAGTCCAGCCGGAGCGTCAGGCGCAACGTCAACGACCTCTTTGACGAGAGG
GGGCCGGAATGGTACGGAGCCTGTCCTTGAGCCGATATCCATGTCTCGACGGTGTTCTAATCCTGTACCCTTGCC
GGGATGCAGGGACCTCTACGTGCAGGCGCTCAGTGCCATGCAGGATGCCGACTCGGACGATCCCCTGTCGTGGTT
CCAAATCGGAGGTAACTTGCAGGCCGGTACGGACGGTGCTTCTCGCTCGATGGCTGACCTGCCCCAGCGATCCAC
GGCCAGCCGCGCATCGAGTGGAACAACACTGGCCGTGGAATTCCTGGCAATGATGCAGGCTATTGTACTCATAGC
GTAGGTGCTTCTCGAATCTGGTTCCCGACTACTTACGCATGTCCGCGCAGTTCTCGAGGTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail