Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6115
Gene name
LocationContig_31:35822..37289
Strand-
Gene length (bp)1467
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02116 STE2 Fungal pheromone mating factor STE2 GPCR 1.1E-73 27 309

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0004932 mating-type factor pheromone receptor activity Yes
GO:0016020 membrane Yes
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0007165 signal transduction No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0016503 pheromone receptor activity No
GO:0004888 transmembrane signaling receptor activity No
GO:0038023 signaling receptor activity No
GO:0003674 molecular_function No
GO:0004930 G protein-coupled receptor activity No
GO:0060089 molecular transducer activity No
GO:0001653 peptide receptor activity No
GO:0050794 regulation of cellular process No
GO:0008528 G protein-coupled peptide receptor activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

Domain # Start End Length
1 61 83 22
2 96 118 22
3 140 162 22
4 182 204 22
5 219 241 22
6 262 284 22
7 289 308 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6115
MGSIPPPPPPTAIVDEPPPPPPPDSLFDPVLQDVRFYGADGATVLAVPLPAVDAFNDESVGLAVNAGAQLGASLV
MLAALLALTPGPAARLRRPSALLQLAGLLVCLVRAGLLVHDGLKPSMHFYVYWSGDVGAAPAADSVFLAAGHVVN
LLLVLVVELALVHQAWAMVSLWPPAARYGLGLASALVTLAAMGFRLAFTVLLIRNDAGSRAGFLWLTKTTLVTNA
LSIFWFCALFNAKLLLHLISKRGLLPSARSLSSMEVLVMTNGVLMVVPVIFAGLEWGHFPNFEPAALTVASVAII
LPLGTLAAQRMTFNSSSAASNFAFVPNSGSSGANSNNNNSGNNNSRFAGALPRHRSHHPGAGTNSATAISHSSSG
MSAPFKTPSFATSCGSANQTSSLLSKCERGMAGPRAAAAGRAGKGEDHFDLELRQIDSSSALTASDLRFDSHMEK
QDDRS*
Coding >Hirsu2|6115
ATGGGCTCGATCCCGCCGCCGCCGCCGCCAACGGCCATCGTCGACGAGCCGCCGCCGCCGCCGCCGCCGGACAGC
CTCTTCGACCCCGTCCTCCAGGACGTCCGCTTCTACGGCGCGGACGGGGCAACGGTGCTGGCGGTGCCGCTGCCG
GCCGTCGACGCCTTCAACGACGAGTCGGTCGGCCTGGCCGTCAACGCGGGCGCCCAGCTCGGGGCCAGCCTGGTG
ATGCTGGCGGCGCTGCTGGCGCTGACGCCCGGCCCGGCGGCGCGCCTGCGCCGGCCGTCGGCCCTGCTGCAGCTC
GCCGGCCTGCTGGTGTGCCTGGTCCGGGCCGGCCTGCTGGTGCACGACGGGCTCAAGCCGAGCATGCACTTCTAC
GTCTACTGGTCCGGCGATGTCGGCGCCGCGCCCGCCGCCGACTCCGTCTTCCTCGCCGCCGGCCACGTCGTCAAC
CTGCTGCTGGTCCTCGTTGTCGAGCTCGCCCTCGTCCACCAGGCTTGGGCCATGGTCTCGCTCTGGCCGCCCGCC
GCCCGCTACGGCCTCGGCCTCGCCTCTGCTCTCGTCACCCTCGCTGCCATGGGCTTCCGCCTCGCCTTCACCGTC
CTGCTCATCCGCAACGACGCCGGCTCCCGCGCCGGCTTCCTCTGGCTCACCAAGACGACCCTCGTCACCAACGCG
CTGTCCATCTTCTGGTTCTGCGCCCTCTTCAACGCCAAGCTGCTCCTCCATCTCATCTCCAAGCGTGGCCTCCTG
CCCTCGGCCAGGTCCCTCAGCTCCATGGAGGTGCTCGTCATGACCAACGGCGTCCTCATGGTCGTCCCAGTCATC
TTCGCCGGCTTGGAATGGGGCCACTTCCCAAACTTCGAGCCCGCCGCTCTGACCGTCGCCTCCGTCGCCATCATC
TTGCCCCTTGGCACCCTGGCCGCCCAGCGCATGACGTTCAACTCCAGCAGCGCCGCCAGCAACTTCGCCTTCGTC
CCCAACAGCGGCTCCTCGGGAGCCAACAGCAACAACAACAACAGCGGCAATAACAACAGTCGCTTTGCCGGCGCC
CTCCCTCGCCACAGGAGCCACCACCCCGGCGCCGGCACAAACAGCGCGACCGCCATCTCCCACTCCTCCTCAGGC
ATGTCGGCACCCTTCAAGACGCCTAGCTTCGCCACCAGCTGCGGCTCGGCAAACCAGACCTCGTCCCTGCTGTCC
AAGTGCGAGCGTGGCATGGCCGGTCCCAGGGCCGCTGCCGCAGGGCGAGCGGGAAAGGGGGAGGACCATTTCGAC
CTCGAGTTGCGCCAGATCGACTCCTCCAGCGCCCTCACCGCCTCTGATTTGCGCTTCGACAGCCATATGGAGAAG
CAGGATGACAGAAGTTAG
Transcript >Hirsu2|6115
ATGGGCTCGATCCCGCCGCCGCCGCCGCCAACGGCCATCGTCGACGAGCCGCCGCCGCCGCCGCCGCCGGACAGC
CTCTTCGACCCCGTCCTCCAGGACGTCCGCTTCTACGGCGCGGACGGGGCAACGGTGCTGGCGGTGCCGCTGCCG
GCCGTCGACGCCTTCAACGACGAGTCGGTCGGCCTGGCCGTCAACGCGGGCGCCCAGCTCGGGGCCAGCCTGGTG
ATGCTGGCGGCGCTGCTGGCGCTGACGCCCGGCCCGGCGGCGCGCCTGCGCCGGCCGTCGGCCCTGCTGCAGCTC
GCCGGCCTGCTGGTGTGCCTGGTCCGGGCCGGCCTGCTGGTGCACGACGGGCTCAAGCCGAGCATGCACTTCTAC
GTCTACTGGTCCGGCGATGTCGGCGCCGCGCCCGCCGCCGACTCCGTCTTCCTCGCCGCCGGCCACGTCGTCAAC
CTGCTGCTGGTCCTCGTTGTCGAGCTCGCCCTCGTCCACCAGGCTTGGGCCATGGTCTCGCTCTGGCCGCCCGCC
GCCCGCTACGGCCTCGGCCTCGCCTCTGCTCTCGTCACCCTCGCTGCCATGGGCTTCCGCCTCGCCTTCACCGTC
CTGCTCATCCGCAACGACGCCGGCTCCCGCGCCGGCTTCCTCTGGCTCACCAAGACGACCCTCGTCACCAACGCG
CTGTCCATCTTCTGGTTCTGCGCCCTCTTCAACGCCAAGCTGCTCCTCCATCTCATCTCCAAGCGTGGCCTCCTG
CCCTCGGCCAGGTCCCTCAGCTCCATGGAGGTGCTCGTCATGACCAACGGCGTCCTCATGGTCGTCCCAGTCATC
TTCGCCGGCTTGGAATGGGGCCACTTCCCAAACTTCGAGCCCGCCGCTCTGACCGTCGCCTCCGTCGCCATCATC
TTGCCCCTTGGCACCCTGGCCGCCCAGCGCATGACGTTCAACTCCAGCAGCGCCGCCAGCAACTTCGCCTTCGTC
CCCAACAGCGGCTCCTCGGGAGCCAACAGCAACAACAACAACAGCGGCAATAACAACAGTCGCTTTGCCGGCGCC
CTCCCTCGCCACAGGAGCCACCACCCCGGCGCCGGCACAAACAGCGCGACCGCCATCTCCCACTCCTCCTCAGGC
ATGTCGGCACCCTTCAAGACGCCTAGCTTCGCCACCAGCTGCGGCTCGGCAAACCAGACCTCGTCCCTGCTGTCC
AAGTGCGAGCGTGGCATGGCCGGTCCCAGGGCCGCTGCCGCAGGGCGAGCGGGAAAGGGGGAGGACCATTTCGAC
CTCGAGTTGCGCCAGATCGACTCCTCCAGCGCCCTCACCGCCTCTGATTTGCGCTTCGACAGCCATATGGAGAAG
CAGGATGACAGAAGTTAG
Gene >Hirsu2|6115
ATGGGCTCGATCCCGCCGCCGCCGCCGCCAACGGCCATCGTCGACGAGCCGCCGCCGCCGCCGCCGCCGGACAGC
CTCTTCGACCCCGTCCTCCAGGACGTCCGCTTCTACGGCGCGGACGGGGCAACGGTGCTGGCGGTGCCGCTGCCG
GCCGTCGACGCCTTCAACGACGAGTCGGTCGGCCTGGCCGTCAACGCGGGCGCCCAGCTCGGGGCCAGCCTGGTG
ATGCTGGCGGCGCTGCTGGCGCTGACGCCCGGCCCGGCGGCGCGCCTGCGCCGGCCGTCGGCCCTGCTGCAGCTC
GCCGGCCTGCTGGTGTGCCTGGTCCGGGCCGGCCTGCTGGTGCACGACGGGCTCAAGCCGAGCATGCACTTCTAC
GTCTACTGGTCCGGCGATGTCGGCGCCGCGCCCGCCGCCGACTCCGTCTTCCTCGCCGCCGGCCACGTCGTCAAC
CTGCTGCTGGTCCTCGTTGTCGAGCTCGCCCTCGTCCACCAGGCTTGGGCCATGGTCTCGCTCTGGCCGCCCGCC
GCCCGCTACGGCCTCGGCCTCGCCTCTGCTCTCGTCACCCTCGCTGCCATGGGCTTCCGCCTCGCCTTCACCGTC
CTGCTCATCCGCAACGACGCCGGCTCCCGCGCCGGCTTCCTCTGGCTCACCAAGACGACCCTCGTCACCAACGCG
CTGTCCATCTTCTGGTTCTGCGCCCTCTTCAACGCCAAGCTGCTCCTCCATCTCATCTCCAAGCGTGGCCTCCTG
CCCTCGGCCAGGTCCCTCAGCTCCATGGAGGTGCTCGTCATGACCAACGGCGTCCTCATGGTCGTCCCAGGTATT
TCCCTTCCCTTCTCCTCTTCCCTCTTCCTTTCTCCCCTTTTGCCCCGATTATGCAGGCCTCACGCTGACTCCCAT
CGCCTGCTCCCTCCCTCAGTCATCTTCGCCGGCTTGGAATGGGGCCACTTCCCAAACTTCGAGCCCGCCGCTCTG
ACCGTCGCCTCCGTCGCCATCATCTTGCCCCTTGGCACCCTGGCCGCCCAGCGCATGACGTTCAACTCCAGCAGC
GCCGCCAGCAACTTCGCCTTCGTCCCCAACAGCGGCTCCTCGGGAGCCAACAGCAACAACAACAACAGCGGCAAT
AACAACAGTCGCTTTGCCGGCGCCCTCCCTCGCCACAGGAGCCACCACCCCGGCGCCGGCACAAACAGCGCGACC
GCCATCTCCCACTCCTCCTCAGGCATGTCGGCACCCTTCAAGACGCCTAGCTTCGCCACCAGCTGCGGCTCGGCA
AACCAGACCTCGTCCCTGCTGTCCAAGTGCGAGCGTGGCATGGCCGGTCCCAGGGCCGCTGCCGCAGGGCGAGCG
GGAAAGGGGGAGGACCATTTCGACCTCGAGTTGCGCCAGATCGACTCCTCCAGCGCCCTCACCGCCTCTGATTTG
CGCTTCGACAGCCATATGGAGAAGCAGGATGACAGAAGTTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail