Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6112
Gene name
LocationContig_31:30504..31294
Strand-
Gene length (bp)790
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17110 TFB6 Subunit 11 of the general transcription factor TFIIH 8.8E-67 32 217

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6112
MVRRFAEERLLNTSRRYVKKFGNPEPTDTVVGFANFSEVCRELDSLVDVLWVSATPSLQIPFLLKLASDFTQYVR
SFPPAPRATFALLRKLDHCFASLLCGQDIDTKESLPGFENGLRGGMSVTDMVRCRSLVEQTRVLMMEILSGADEQ
EEEDDEEEEEDEDEDDVDMDLARDATRAASDTGQARRIRTPTTWDIDEERLHMDAARIYEHTIVQLGTRLGDPLT
GDNVPDNDVPRCRMQD*
Coding >Hirsu2|6112
ATGGTGAGGCGCTTCGCAGAGGAGCGACTGCTGAACACGTCACGGCGCTACGTCAAGAAGTTTGGGAACCCGGAA
CCGACCGACACCGTCGTCGGTTTCGCCAACTTTAGCGAAGTATGCCGTGAGCTGGACAGTCTTGTCGACGTCCTC
TGGGTCTCGGCGACCCCCAGCCTCCAGATCCCCTTCCTCTTGAAGCTAGCGAGCGATTTCACGCAATACGTCCGA
TCCTTCCCGCCGGCGCCAAGGGCAACATTTGCGCTATTGAGGAAGCTCGACCACTGCTTCGCCAGCCTGCTCTGC
GGCCAGGACATCGACACCAAAGAATCGCTGCCGGGATTCGAGAACGGACTGCGTGGAGGCATGTCCGTCACCGAC
ATGGTCCGCTGTCGCAGTCTGGTGGAGCAGACCAGGGTGCTCATGATGGAGATTCTAAGTGGGGCAGATGAGCAA
GAAGAAGAGGATGATGAAGAAGAAGAAGAGGACGAGGACGAAGACGATGTTGATATGGACCTGGCTCGGGATGCA
ACTCGCGCCGCGTCGGATACAGGCCAAGCCCGTAGGATTCGGACGCCAACTACGTGGGACATCGATGAGGAAAGG
CTGCACATGGATGCAGCGAGGATTTACGAGCACACCATCGTCCAGCTAGGGACCAGACTGGGGGATCCGCTGACC
GGCGACAACGTGCCAGACAACGATGTCCCTCGCTGTCGGATGCAGGACTGA
Transcript >Hirsu2|6112
ATGGTGAGGCGCTTCGCAGAGGAGCGACTGCTGAACACGTCACGGCGCTACGTCAAGAAGTTTGGGAACCCGGAA
CCGACCGACACCGTCGTCGGTTTCGCCAACTTTAGCGAAGTATGCCGTGAGCTGGACAGTCTTGTCGACGTCCTC
TGGGTCTCGGCGACCCCCAGCCTCCAGATCCCCTTCCTCTTGAAGCTAGCGAGCGATTTCACGCAATACGTCCGA
TCCTTCCCGCCGGCGCCAAGGGCAACATTTGCGCTATTGAGGAAGCTCGACCACTGCTTCGCCAGCCTGCTCTGC
GGCCAGGACATCGACACCAAAGAATCGCTGCCGGGATTCGAGAACGGACTGCGTGGAGGCATGTCCGTCACCGAC
ATGGTCCGCTGTCGCAGTCTGGTGGAGCAGACCAGGGTGCTCATGATGGAGATTCTAAGTGGGGCAGATGAGCAA
GAAGAAGAGGATGATGAAGAAGAAGAAGAGGACGAGGACGAAGACGATGTTGATATGGACCTGGCTCGGGATGCA
ACTCGCGCCGCGTCGGATACAGGCCAAGCCCGTAGGATTCGGACGCCAACTACGTGGGACATCGATGAGGAAAGG
CTGCACATGGATGCAGCGAGGATTTACGAGCACACCATCGTCCAGCTAGGGACCAGACTGGGGGATCCGCTGACC
GGCGACAACGTGCCAGACAACGATGTCCCTCGCTGTCGGATGCAGGACTGA
Gene >Hirsu2|6112
ATGGTGAGGCGCTTCGCAGAGGAGCGACTGCTGAACACGTCACGGCGCTACGTCAAGAAGTTTGGGAACCCGGAA
CCGACCGACACCGTCGTCGGTTTCGCCAACTTTAGCGAAGTATGCCGTGAGCTGGACAGTCTTGTCGACGTCCTC
TGGGTCTCGGCGACCCGTACGTCCTCCTAATTCCCGTGCATCGGGGTCACGGGAACATTCTAGCTGATGATTAGC
CGCAGCCAGCCTCCAGATCCCCTTCCTCTTGAAGCTAGCGAGCGATTTCACGCAATACGTCCGATCCTTCCCGCC
GGCGCCAAGGGCAACATTTGCGCTATTGAGGAAGCTCGACCACTGCTTCGCCAGCCTGCTCTGCGGCCAGGACAT
CGACACCAAAGAATCGCTGCCGGGATTCGAGAACGGACTGCGTGGAGGCATGTCCGTCACCGACATGGTCCGCTG
TCGCAGTCTGGTGGAGCAGACCAGGGTGCTCATGATGGAGATTCTAAGTGGGGCAGATGAGCAAGAAGAAGAGGA
TGATGAAGAAGAAGAAGAGGACGAGGACGAAGACGATGTTGATATGGACCTGGCTCGGGATGCAACTCGCGCCGC
GTCGGATACAGGCCAAGCCCGTAGGATTCGGACGCCAACTACGTGGGACATCGATGAGGAAAGGCTGCACATGGA
TGCAGCGAGGATTTACGAGCACACCATCGTCCAGCTAGGGACCAGACTGGGGGATCCGCTGACCGGCGACAACGT
GCCAGACAACGATGTCCCTCGCTGTCGGATGCAGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail