Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6107
Gene name
LocationContig_31:7219..8557
Strand-
Gene length (bp)1338
Transcript length (bp)1338
Coding sequence length (bp)1338
Protein length (aa) 446

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 3.1E-12 174 250

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UTR6|OCH1_SCHPO Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=och1 PE=1 SV=2 176 424 5.0E-41
sp|Q5A4E3|OCH1_CANAL Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OCH1 PE=3 SV=1 171 425 9.0E-34
sp|P31755|OCH1_YEAST Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OCH1 PE=1 SV=1 181 429 7.0E-26
sp|P47124|HOC1_YEAST Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOC1 PE=1 SV=3 179 426 1.0E-25

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.5

Transmembrane Domains

Domain # Start End Length
1 52 74 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6107
MEKDTRAASSSPGSTASDTGLRKPATLLMALATAVERVLHPSSARTRMARNVLIGLVLAAMALGLLQFSFHYYHH
YAAVGLQFRHPRPPAASPSPDGHRLPPAGWTHAQEARPGGEDGQTEQEPGIPRKIWQIFLRPPGAEAAAAAAAAE
EEEEEEEEEEEDHKAATVDVKHLTDTASWIAQNPDYSYVLLDDAGAAAMLRRHYGGNATLLRIFDQVRNTGLKSD
LLRYLVLAAEGGVYADTDTEALRPIGGWVPARLRPAARLVVGVEFDRLDGPNWGDVHEELQFCQWTIAAAPGHPV
FGAMVDSVLAALAARAGRDGIALSGDDGGPSLARLNFSAGDVLRLTGPMAWTDVLFDHLAAVDGSVTSLRDLSGL
REPRLVDDVLVLPIDGFGTGQTHSNSTRDGPTPPDALVRHKFRGSWRNNGKRSASPGPEGGRRRARVALP*
Coding >Hirsu2|6107
ATGGAAAAGGACACAAGGGCGGCCTCATCGTCGCCCGGATCGACGGCCTCGGACACGGGGCTGCGAAAGCCAGCG
ACCCTCCTGATGGCGCTGGCGACAGCAGTCGAGCGGGTGCTGCACCCGTCGAGCGCGCGGACGCGGATGGCGAGA
AATGTCTTGATAGGCCTCGTGCTGGCGGCCATGGCCTTGGGCCTGCTGCAGTTCAGCTTCCACTACTACCACCAC
TACGCCGCGGTCGGCCTGCAGTTTCGACATCCGCGGCCGCCGGCGGCGAGCCCGAGCCCGGACGGCCACCGACTC
CCGCCGGCGGGCTGGACGCACGCGCAGGAGGCCCGGCCCGGCGGCGAAGACGGACAGACGGAGCAGGAGCCGGGC
ATCCCGCGCAAGATCTGGCAGATCTTCCTCCGGCCGCCCGGAGCGGAGGCGGCGGCGGCGGCGGCGGCGGCGGAG
GAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGATCACAAGGCGGCGACGGTGGACGTCAAGCACCTGACGGAC
ACGGCTTCGTGGATCGCGCAGAACCCGGACTACTCGTACGTGCTGCTGGACGACGCGGGCGCGGCGGCGATGCTG
CGCCGGCACTACGGCGGCAACGCGACGCTGCTGCGCATCTTCGACCAGGTGCGCAACACGGGCCTCAAGTCGGAC
CTGCTGCGGTACCTGGTGCTGGCGGCCGAGGGCGGCGTCTACGCCGACACGGACACGGAGGCGCTGCGGCCCATC
GGCGGCTGGGTGCCGGCCCGGCTCCGGCCGGCGGCGCGGCTGGTCGTCGGCGTCGAGTTCGACCGGCTGGACGGC
CCCAACTGGGGCGACGTGCACGAGGAGCTGCAGTTCTGCCAGTGGACCATCGCCGCCGCGCCGGGCCACCCGGTC
TTCGGCGCCATGGTCGACTCGGTCCTGGCCGCGCTGGCGGCCCGCGCCGGCCGCGACGGCATCGCCCTCTCCGGC
GACGACGGCGGCCCGTCGCTGGCGCGCCTCAACTTCAGCGCCGGCGACGTCCTGCGCCTGACGGGCCCCATGGCC
TGGACCGACGTCCTCTTCGACCACCTGGCCGCCGTCGACGGCTCCGTCACGTCGCTGCGCGACCTCAGCGGCCTG
CGCGAGCCGCGCCTGGTCGACGACGTCCTCGTCCTGCCCATCGACGGCTTCGGCACCGGCCAGACGCACTCCAAC
AGCACCCGCGACGGGCCCACGCCCCCGGACGCCCTCGTCCGCCACAAGTTCCGCGGCTCCTGGCGGAACAACGGG
AAGCGGTCCGCCTCGCCCGGCCCGGAGGGCGGCCGGCGACGGGCGCGAGTCGCGCTTCCATGA
Transcript >Hirsu2|6107
ATGGAAAAGGACACAAGGGCGGCCTCATCGTCGCCCGGATCGACGGCCTCGGACACGGGGCTGCGAAAGCCAGCG
ACCCTCCTGATGGCGCTGGCGACAGCAGTCGAGCGGGTGCTGCACCCGTCGAGCGCGCGGACGCGGATGGCGAGA
AATGTCTTGATAGGCCTCGTGCTGGCGGCCATGGCCTTGGGCCTGCTGCAGTTCAGCTTCCACTACTACCACCAC
TACGCCGCGGTCGGCCTGCAGTTTCGACATCCGCGGCCGCCGGCGGCGAGCCCGAGCCCGGACGGCCACCGACTC
CCGCCGGCGGGCTGGACGCACGCGCAGGAGGCCCGGCCCGGCGGCGAAGACGGACAGACGGAGCAGGAGCCGGGC
ATCCCGCGCAAGATCTGGCAGATCTTCCTCCGGCCGCCCGGAGCGGAGGCGGCGGCGGCGGCGGCGGCGGCGGAG
GAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGATCACAAGGCGGCGACGGTGGACGTCAAGCACCTGACGGAC
ACGGCTTCGTGGATCGCGCAGAACCCGGACTACTCGTACGTGCTGCTGGACGACGCGGGCGCGGCGGCGATGCTG
CGCCGGCACTACGGCGGCAACGCGACGCTGCTGCGCATCTTCGACCAGGTGCGCAACACGGGCCTCAAGTCGGAC
CTGCTGCGGTACCTGGTGCTGGCGGCCGAGGGCGGCGTCTACGCCGACACGGACACGGAGGCGCTGCGGCCCATC
GGCGGCTGGGTGCCGGCCCGGCTCCGGCCGGCGGCGCGGCTGGTCGTCGGCGTCGAGTTCGACCGGCTGGACGGC
CCCAACTGGGGCGACGTGCACGAGGAGCTGCAGTTCTGCCAGTGGACCATCGCCGCCGCGCCGGGCCACCCGGTC
TTCGGCGCCATGGTCGACTCGGTCCTGGCCGCGCTGGCGGCCCGCGCCGGCCGCGACGGCATCGCCCTCTCCGGC
GACGACGGCGGCCCGTCGCTGGCGCGCCTCAACTTCAGCGCCGGCGACGTCCTGCGCCTGACGGGCCCCATGGCC
TGGACCGACGTCCTCTTCGACCACCTGGCCGCCGTCGACGGCTCCGTCACGTCGCTGCGCGACCTCAGCGGCCTG
CGCGAGCCGCGCCTGGTCGACGACGTCCTCGTCCTGCCCATCGACGGCTTCGGCACCGGCCAGACGCACTCCAAC
AGCACCCGCGACGGGCCCACGCCCCCGGACGCCCTCGTCCGCCACAAGTTCCGCGGCTCCTGGCGGAACAACGGG
AAGCGGTCCGCCTCGCCCGGCCCGGAGGGCGGCCGGCGACGGGCGCGAGTCGCGCTTCCATGA
Gene >Hirsu2|6107
ATGGAAAAGGACACAAGGGCGGCCTCATCGTCGCCCGGATCGACGGCCTCGGACACGGGGCTGCGAAAGCCAGCG
ACCCTCCTGATGGCGCTGGCGACAGCAGTCGAGCGGGTGCTGCACCCGTCGAGCGCGCGGACGCGGATGGCGAGA
AATGTCTTGATAGGCCTCGTGCTGGCGGCCATGGCCTTGGGCCTGCTGCAGTTCAGCTTCCACTACTACCACCAC
TACGCCGCGGTCGGCCTGCAGTTTCGACATCCGCGGCCGCCGGCGGCGAGCCCGAGCCCGGACGGCCACCGACTC
CCGCCGGCGGGCTGGACGCACGCGCAGGAGGCCCGGCCCGGCGGCGAAGACGGACAGACGGAGCAGGAGCCGGGC
ATCCCGCGCAAGATCTGGCAGATCTTCCTCCGGCCGCCCGGAGCGGAGGCGGCGGCGGCGGCGGCGGCGGCGGAG
GAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGATCACAAGGCGGCGACGGTGGACGTCAAGCACCTGACGGAC
ACGGCTTCGTGGATCGCGCAGAACCCGGACTACTCGTACGTGCTGCTGGACGACGCGGGCGCGGCGGCGATGCTG
CGCCGGCACTACGGCGGCAACGCGACGCTGCTGCGCATCTTCGACCAGGTGCGCAACACGGGCCTCAAGTCGGAC
CTGCTGCGGTACCTGGTGCTGGCGGCCGAGGGCGGCGTCTACGCCGACACGGACACGGAGGCGCTGCGGCCCATC
GGCGGCTGGGTGCCGGCCCGGCTCCGGCCGGCGGCGCGGCTGGTCGTCGGCGTCGAGTTCGACCGGCTGGACGGC
CCCAACTGGGGCGACGTGCACGAGGAGCTGCAGTTCTGCCAGTGGACCATCGCCGCCGCGCCGGGCCACCCGGTC
TTCGGCGCCATGGTCGACTCGGTCCTGGCCGCGCTGGCGGCCCGCGCCGGCCGCGACGGCATCGCCCTCTCCGGC
GACGACGGCGGCCCGTCGCTGGCGCGCCTCAACTTCAGCGCCGGCGACGTCCTGCGCCTGACGGGCCCCATGGCC
TGGACCGACGTCCTCTTCGACCACCTGGCCGCCGTCGACGGCTCCGTCACGTCGCTGCGCGACCTCAGCGGCCTG
CGCGAGCCGCGCCTGGTCGACGACGTCCTCGTCCTGCCCATCGACGGCTTCGGCACCGGCCAGACGCACTCCAAC
AGCACCCGCGACGGGCCCACGCCCCCGGACGCCCTCGTCCGCCACAAGTTCCGCGGCTCCTGGCGGAACAACGGG
AAGCGGTCCGCCTCGCCCGGCCCGGAGGGCGGCCGGCGACGGGCGCGAGTCGCGCTTCCATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail