Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6104
Gene name
LocationContig_3099:627..1023
Strand-
Gene length (bp)396
Transcript length (bp)396
Coding sequence length (bp)396
Protein length (aa) 132

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04511 DER1 Der1-like family 2.5E-07 2 77

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5R9W3|DERL1_PONAB Derlin-1 OS=Pongo abelii GN=DERL1 PE=2 SV=1 3 80 2.0E-06
sp|Q9BUN8|DERL1_HUMAN Derlin-1 OS=Homo sapiens GN=DERL1 PE=1 SV=1 3 80 2.0E-06
sp|Q71SS4|DERL1_BOVIN Derlin-1 OS=Bos taurus GN=DERL1 PE=2 SV=1 3 80 2.0E-06
sp|Q93561|DERL1_CAEEL Derlin-1 OS=Caenorhabditis elegans GN=cup-2 PE=2 SV=1 3 115 6.0E-06
sp|Q99J56|DERL1_MOUSE Derlin-1 OS=Mus musculus GN=Derl1 PE=1 SV=1 3 80 6.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6104
MSYTATQEQRGMKVNYMFITIPAQLSPYAMLAFNLLFPGGAMNMLLQVQGLLAGHLYEFLTRIWPEYGGGRNLIP
TPAFMTTVVRTAGTVQARLAAMLGMQGAPAGPGGAGSQRGPLPDSWRTRGPGHRLG*
Coding >Hirsu2|6104
ATGTCGTACACGGCGACGCAGGAACAGCGGGGGATGAAGGTCAACTACATGTTCATCACCATCCCCGCCCAGCTG
TCGCCCTACGCCATGCTGGCCTTCAACCTCCTCTTCCCCGGCGGCGCCATGAACATGCTGCTGCAGGTCCAAGGC
CTGCTCGCCGGCCATCTGTACGAGTTCCTGACCCGGATTTGGCCCGAGTACGGAGGGGGCAGGAACCTGATTCCC
ACGCCTGCCTTCATGACGACGGTGGTGCGGACTGCCGGAACGGTGCAGGCAAGGTTGGCGGCAATGCTGGGAATG
CAGGGCGCGCCGGCCGGTCCAGGAGGTGCTGGGTCCCAGAGAGGGCCGCTGCCCGACTCGTGGCGAACTCGGGGT
CCTGGGCACCGTCTGGGATGA
Transcript >Hirsu2|6104
ATGTCGTACACGGCGACGCAGGAACAGCGGGGGATGAAGGTCAACTACATGTTCATCACCATCCCCGCCCAGCTG
TCGCCCTACGCCATGCTGGCCTTCAACCTCCTCTTCCCCGGCGGCGCCATGAACATGCTGCTGCAGGTCCAAGGC
CTGCTCGCCGGCCATCTGTACGAGTTCCTGACCCGGATTTGGCCCGAGTACGGAGGGGGCAGGAACCTGATTCCC
ACGCCTGCCTTCATGACGACGGTGGTGCGGACTGCCGGAACGGTGCAGGCAAGGTTGGCGGCAATGCTGGGAATG
CAGGGCGCGCCGGCCGGTCCAGGAGGTGCTGGGTCCCAGAGAGGGCCGCTGCCCGACTCGTGGCGAACTCGGGGT
CCTGGGCACCGTCTGGGATGA
Gene >Hirsu2|6104
ATGTCGTACACGGCGACGCAGGAACAGCGGGGGATGAAGGTCAACTACATGTTCATCACCATCCCCGCCCAGCTG
TCGCCCTACGCCATGCTGGCCTTCAACCTCCTCTTCCCCGGCGGCGCCATGAACATGCTGCTGCAGGTCCAAGGC
CTGCTCGCCGGCCATCTGTACGAGTTCCTGACCCGGATTTGGCCCGAGTACGGAGGGGGCAGGAACCTGATTCCC
ACGCCTGCCTTCATGACGACGGTGGTGCGGACTGCCGGAACGGTGCAGGCAAGGTTGGCGGCAATGCTGGGAATG
CAGGGCGCGCCGGCCGGTCCAGGAGGTGCTGGGTCCCAGAGAGGGCCGCTGCCCGACTCGTGGCGAACTCGGGGT
CCTGGGCACCGTCTGGGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail