Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|609
Gene name
LocationContig_112:33540..35132
Strand-
Gene length (bp)1592
Transcript length (bp)1452
Coding sequence length (bp)1452
Protein length (aa) 484

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus 5.0E-41 10 169

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I6A4|HAT1_GIBZE Histone acetyltransferase type B catalytic subunit OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAT1 PE=3 SV=2 4 482 0.0E+00
sp|Q7RYU8|HAT1_NEUCR Histone acetyltransferase type B catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hat-1 PE=3 SV=1 8 479 4.0E-146
sp|Q2UEX1|HAT1_ASPOR Histone acetyltransferase type B catalytic subunit OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hat1 PE=3 SV=1 9 460 6.0E-87
sp|Q4X0W8|HAT1_ASPFU Histone acetyltransferase type B catalytic subunit OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hat1 PE=3 SV=1 4 442 2.0E-85
sp|Q5AZR6|HAT1_EMENI Histone acetyltransferase type B catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hat1 PE=3 SV=1 9 443 3.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I6A4|HAT1_GIBZE Histone acetyltransferase type B catalytic subunit OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAT1 PE=3 SV=2 4 482 0.0E+00
sp|Q7RYU8|HAT1_NEUCR Histone acetyltransferase type B catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hat-1 PE=3 SV=1 8 479 4.0E-146
sp|Q2UEX1|HAT1_ASPOR Histone acetyltransferase type B catalytic subunit OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hat1 PE=3 SV=1 9 460 6.0E-87
sp|Q4X0W8|HAT1_ASPFU Histone acetyltransferase type B catalytic subunit OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hat1 PE=3 SV=1 4 442 2.0E-85
sp|Q5AZR6|HAT1_EMENI Histone acetyltransferase type B catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hat1 PE=3 SV=1 9 443 3.0E-82
sp|Q6CC99|HAT1_YARLI Histone acetyltransferase type B catalytic subunit OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HAT1 PE=3 SV=1 9 442 2.0E-63
sp|Q59VF4|HAT1_CANAL Histone acetyltransferase type B catalytic subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAT1 PE=3 SV=1 8 465 3.0E-54
sp|P0CO06|HAT1_CRYNJ Histone acetyltransferase type B catalytic subunit OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAT1 PE=3 SV=1 7 443 6.0E-52
sp|P0CO07|HAT1_CRYNB Histone acetyltransferase type B catalytic subunit OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAT1 PE=3 SV=1 7 443 6.0E-52
sp|Q6FKS5|HAT1_CANGA Histone acetyltransferase type B catalytic subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAT1 PE=3 SV=1 3 443 3.0E-51
sp|Q6BSQ1|HAT1_DEBHA Histone acetyltransferase type B catalytic subunit OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HAT1 PE=3 SV=2 8 479 2.0E-49
sp|Q6CN95|HAT1_KLULA Histone acetyltransferase type B catalytic subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAT1 PE=3 SV=1 8 466 4.0E-47
sp|Q9UTM7|HAT1_SCHPO Histone acetyltransferase type B catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hat1 PE=3 SV=2 1 442 6.0E-45
sp|Q4PBE6|HAT1_USTMA Histone acetyltransferase type B catalytic subunit OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAT1 PE=3 SV=1 36 479 4.0E-43
sp|Q750F5|HAT1_ASHGO Histone acetyltransferase type B catalytic subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HAT1 PE=3 SV=2 8 442 7.0E-43
sp|Q12341|HAT1_YEAST Histone acetyltransferase type B catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAT1 PE=1 SV=1 3 448 4.0E-38
sp|Q869X7|HAT12_DICDI Histone acetyltransferase type B catalytic subunit DDB_G0275159 OS=Dictyostelium discoideum GN=DDB_G0275159 PE=3 SV=1 34 431 3.0E-27
sp|O14929|HAT1_HUMAN Histone acetyltransferase type B catalytic subunit OS=Homo sapiens GN=HAT1 PE=1 SV=1 9 436 1.0E-26
sp|Q86J12|HAT11_DICDI Histone acetyltransferase type B catalytic subunit DDB_G0274269 OS=Dictyostelium discoideum GN=DDB_G0274269 PE=3 SV=1 32 440 2.0E-26
sp|Q8BY71|HAT1_MOUSE Histone acetyltransferase type B catalytic subunit OS=Mus musculus GN=Hat1 PE=1 SV=1 9 436 5.0E-24
sp|Q5M939|HAT1_RAT Histone acetyltransferase type B catalytic subunit OS=Rattus norvegicus GN=Hat1 PE=2 SV=1 9 436 1.0E-23
sp|Q9FJT8|HATB_ARATH Histone acetyltransferase type B catalytic subunit OS=Arabidopsis thaliana GN=HAG2 PE=2 SV=1 14 392 5.0E-19
sp|Q6ES10|HAT1_ORYSJ Probable histone acetyltransferase type B catalytic subunit OS=Oryza sativa subsp. japonica GN=HATB PE=2 SV=1 14 380 1.0E-18
sp|Q8LPU4|HAT1_MAIZE Histone acetyltransferase type B catalytic subunit OS=Zea mays GN=HAT1 PE=1 SV=2 14 380 9.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0006325 chromatin organization Yes
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0016043 cellular component organization No
GO:0071840 cellular component organization or biogenesis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|609
MAAVTDFEEWLESANEALAISLESPTASGLKPIATFHPKFTYSIFGEEEKIFGYQGLKISLRFRANDMRPLLHTS
FAKKLKPRPGAEEPTDVSAVLEEGRHLPKVAFVKGSDFENSSKQLVDNWAPPGALHAKIDAADGQYEIWRGSLAD
PAVQQLNSRVQILVPLFIEGGTYIGQKPDSPELDLSEADRWTVFFLYKTQKSGQDPDKTSYVFVGYATVHRFFYF
QRPTPPPSPGKDWELPQGDLDLAELPCRTRLSQFIILPPFQGAGNGARLYKTIFDHYHQHPQTHEFTVEDPNESF
DDLRDVCDLAYLRTVPQFDALSLDTSVSIPESGSIPPLIVGGNALESIRRKTKIAPRQFARVLEMHLMSRLPASV
RPTLDLDSTVPSPTKADKQQERVWQLIVKQRLYRHNRDVLSQIPLGERIEKLRETLTSVELEYARLLAAHDRAAA
HTSEEAQQQPSAKRRLGETEGEPSSKKARRGDE*
Coding >Hirsu2|609
ATGGCCGCCGTGACCGACTTCGAAGAGTGGCTGGAGAGCGCGAATGAGGCGCTCGCCATCAGCCTCGAGTCGCCG
ACGGCGTCTGGGCTGAAGCCCATCGCCACCTTCCATCCCAAGTTCACGTACTCGATCTTCGGCGAGGAGGAAAAG
ATCTTTGGCTACCAGGGCCTGAAAATCAGCCTGCGATTCCGCGCTAATGACATGCGGCCGCTCCTGCACACCTCG
TTTGCCAAGAAGCTGAAGCCGCGTCCCGGTGCCGAAGAGCCCACCGACGTGTCGGCTGTGCTGGAAGAGGGCCGC
CATCTGCCAAAAGTTGCGTTTGTCAAGGGATCCGACTTCGAGAACAGCTCGAAGCAGCTCGTCGACAACTGGGCG
CCTCCCGGTGCTCTTCACGCGAAAATCGATGCTGCCGACGGCCAGTACGAGATTTGGAGGGGCAGCCTGGCCGAT
CCGGCCGTTCAGCAGCTCAACAGTCGCGTCCAGATTCTGGTTCCGCTCTTCATCGAGGGCGGAACGTACATCGGG
CAGAAACCCGACTCGCCCGAGTTAGATCTCTCCGAGGCCGACCGCTGGACCGTCTTCTTCCTCTACAAAACGCAA
AAGTCCGGCCAAGACCCCGACAAGACTTCGTACGTCTTTGTCGGCTACGCCACCGTCCACCGCTTCTTCTATTTT
CAGCGGCCGACGCCGCCGCCGTCCCCGGGCAAAGACTGGGAGCTGCCGCAAGGGGACCTCGACCTGGCCGAGCTC
CCCTGCCGCACAAGACTCTCGCAATTCATCATCCTGCCACCTTTCCAGGGGGCGGGCAACGGAGCCCGCCTCTAC
AAAACTATCTTCGACCACTATCACCAGCATCCCCAGACGCACGAGTTCACTGTCGAGGACCCCAACGAGTCGTTC
GATGACCTCCGCGATGTCTGCGATCTGGCCTATCTACGCACTGTTCCCCAGTTCGATGCACTGAGTCTGGACACC
TCGGTTTCGATACCCGAGTCTGGGTCAATCCCGCCCCTGATCGTCGGTGGCAACGCTCTCGAAAGTATACGGCGA
AAGACCAAGATTGCTCCTCGCCAATTCGCACGAGTCCTCGAGATGCACTTAATGTCGCGGCTGCCTGCGTCCGTT
CGTCCGACTCTCGATCTCGATAGCACCGTCCCATCGCCGACCAAGGCCGACAAACAGCAGGAAAGGGTTTGGCAG
CTGATTGTCAAGCAAAGACTGTACCGGCACAACAGGGATGTTCTCTCGCAGATTCCGCTCGGTGAGCGGATCGAA
AAGCTGCGCGAGACTTTGACGAGCGTCGAGCTCGAGTACGCCCGGCTGCTGGCCGCCCATGACCGGGCTGCGGCG
CACACATCCGAAGAGGCCCAACAGCAGCCGAGCGCAAAGCGAAGACTAGGCGAAACAGAAGGCGAGCCGTCAAGC
AAGAAGGCGAGGCGTGGGGATGAGTGA
Transcript >Hirsu2|609
ATGGCCGCCGTGACCGACTTCGAAGAGTGGCTGGAGAGCGCGAATGAGGCGCTCGCCATCAGCCTCGAGTCGCCG
ACGGCGTCTGGGCTGAAGCCCATCGCCACCTTCCATCCCAAGTTCACGTACTCGATCTTCGGCGAGGAGGAAAAG
ATCTTTGGCTACCAGGGCCTGAAAATCAGCCTGCGATTCCGCGCTAATGACATGCGGCCGCTCCTGCACACCTCG
TTTGCCAAGAAGCTGAAGCCGCGTCCCGGTGCCGAAGAGCCCACCGACGTGTCGGCTGTGCTGGAAGAGGGCCGC
CATCTGCCAAAAGTTGCGTTTGTCAAGGGATCCGACTTCGAGAACAGCTCGAAGCAGCTCGTCGACAACTGGGCG
CCTCCCGGTGCTCTTCACGCGAAAATCGATGCTGCCGACGGCCAGTACGAGATTTGGAGGGGCAGCCTGGCCGAT
CCGGCCGTTCAGCAGCTCAACAGTCGCGTCCAGATTCTGGTTCCGCTCTTCATCGAGGGCGGAACGTACATCGGG
CAGAAACCCGACTCGCCCGAGTTAGATCTCTCCGAGGCCGACCGCTGGACCGTCTTCTTCCTCTACAAAACGCAA
AAGTCCGGCCAAGACCCCGACAAGACTTCGTACGTCTTTGTCGGCTACGCCACCGTCCACCGCTTCTTCTATTTT
CAGCGGCCGACGCCGCCGCCGTCCCCGGGCAAAGACTGGGAGCTGCCGCAAGGGGACCTCGACCTGGCCGAGCTC
CCCTGCCGCACAAGACTCTCGCAATTCATCATCCTGCCACCTTTCCAGGGGGCGGGCAACGGAGCCCGCCTCTAC
AAAACTATCTTCGACCACTATCACCAGCATCCCCAGACGCACGAGTTCACTGTCGAGGACCCCAACGAGTCGTTC
GATGACCTCCGCGATGTCTGCGATCTGGCCTATCTACGCACTGTTCCCCAGTTCGATGCACTGAGTCTGGACACC
TCGGTTTCGATACCCGAGTCTGGGTCAATCCCGCCCCTGATCGTCGGTGGCAACGCTCTCGAAAGTATACGGCGA
AAGACCAAGATTGCTCCTCGCCAATTCGCACGAGTCCTCGAGATGCACTTAATGTCGCGGCTGCCTGCGTCCGTT
CGTCCGACTCTCGATCTCGATAGCACCGTCCCATCGCCGACCAAGGCCGACAAACAGCAGGAAAGGGTTTGGCAG
CTGATTGTCAAGCAAAGACTGTACCGGCACAACAGGGATGTTCTCTCGCAGATTCCGCTCGGTGAGCGGATCGAA
AAGCTGCGCGAGACTTTGACGAGCGTCGAGCTCGAGTACGCCCGGCTGCTGGCCGCCCATGACCGGGCTGCGGCG
CACACATCCGAAGAGGCCCAACAGCAGCCGAGCGCAAAGCGAAGACTAGGCGAAACAGAAGGCGAGCCGTCAAGC
AAGAAGGCGAGGCGTGGGGATGAGTGA
Gene >Hirsu2|609
ATGGCCGCCGTGACCGACTTCGAAGAGTGTGAGCATCCATCGCCGTGCTTTTCTGCCCACCGTCCGCCCCTTCCA
GCTCGAATAGGCTAACGGTTGGAGATGACAGGGCTGGAGAGCGCGAATGAGGCGCTCGCCATCAGCCTCGAGTCG
CCGACGGCGTCTGGGCTGAAGCCCATCGCCACCTTCCATCCCAAGTTCACGTACTCGATCTTCGGCGAGGAGGAA
AAGATCTTTGGCTACCAGGGCCTGAAAATCAGCCTGCGATTCCGCGCTAATGACATGCGGCCGCTCCTGCACACC
TCGTTTGCCAAGAAGCTGAAGCCGCGTCCCGGTGCCGAAGAGCCCACCGACGTGTCGGCTGTGCTGGAAGAGGGC
CGCCATCTGCCAAAAGGTTGGCCCGACCGCAAAAGCAGCCCTCCTTCTGTCCGTGCCTGAAGCTGACGTTGGTTC
AAGTTGCGTTTGTCAAGGGATCCGACTTCGAGAACAGCTCGAAGCAGCTCGTCGACAACTGGGCGCCTCCCGGTG
CTCTTCACGCGAAAATCGATGCTGCCGACGGCCAGTACGAGATTTGGAGGGGCAGCCTGGCCGATCCGGCCGTTC
AGCAGCTCAACAGTCGCGTCCAGATTCTGGTTCCGCTCTTCATCGAGGGCGGAACGTACATCGGGCAGAAACCCG
ACTCGCCCGAGTTAGATCTCTCCGAGGCCGACCGCTGGACCGTCTTCTTCCTCTACAAAACGCAAAAGTCCGGCC
AAGACCCCGACAAGACTTCGTACGTCTTTGTCGGCTACGCCACCGTCCACCGCTTCTTCTATTTTCAGCGGCCGA
CGCCGCCGCCGTCCCCGGGCAAAGACTGGGAGCTGCCGCAAGGGGACCTCGACCTGGCCGAGCTCCCCTGCCGCA
CAAGACTCTCGCAATTCATCATCCTGCCACCTTTCCAGGGGGCGGGCAACGGAGCCCGCCTCTACAAAACTATCT
TCGACCACTATCACCAGCATCCCCAGACGCACGAGTTCACTGTCGAGGACCCCAACGAGTCGTTCGATGACCTCC
GCGATGTCTGCGATCTGGCCTATCTACGCACTGTTCCCCAGTTCGATGCACTGAGTCTGGACACCTCGGTTTCGA
TACCCGAGTCTGGGTCAATCCCGCCCCTGATCGTCGGTGGCAACGCTCTCGAAAGTATACGGCGAAAGACCAAGA
TTGCTCCTCGCCAATTCGCACGAGTCCTCGAGATGCACTTAATGTCGCGGCTGCCTGCGTCCGTTCGTCCGACTC
TCGATCTCGATAGCACCGTCCCATCGCCGACCAAGGCCGACAAACAGCAGGAAAGGGTTTGGCAGCTGATTGTCA
AGCAAAGACTGTACCGGCACAACAGGGATGTTCTCTCGCAGATTCCGCTCGGTGAGCGGATCGAAAAGCTGCGCG
AGACTTTGACGAGCGTCGAGCTCGAGTACGCCCGGCTGCTGGCCGCCCATGACCGGGCTGCGGCGCACACATCCG
AAGAGGCCCAACAGCAGCCGAGCGCAAAGCGAAGACTAGGCGAAACAGAAGGCGAGCCGTCAAGCAAGAAGGCGA
GGCGTGGGGATGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail