Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6087
Gene name
LocationContig_3082:33..1237
Strand+
Gene length (bp)1204
Transcript length (bp)1155
Coding sequence length (bp)1155
Protein length (aa) 385

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 5.2E-39 176 372
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 7.6E-11 60 125

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P24798|AT1A3_CHICK Sodium/potassium-transporting ATPase subunit alpha-3 OS=Gallus gallus GN=ATP1A3 PE=2 SV=1 33 383 3.0E-50
sp|P13637|AT1A3_HUMAN Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens GN=ATP1A3 PE=1 SV=3 47 383 4.0E-50
sp|P06687|AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus GN=Atp1a3 PE=1 SV=2 47 383 5.0E-50
sp|Q6PIC6|AT1A3_MOUSE Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus GN=Atp1a3 PE=1 SV=1 47 383 5.0E-50
sp|Q6RWA9|AT1A_TAESO Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium PE=2 SV=1 29 383 6.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P24798|AT1A3_CHICK Sodium/potassium-transporting ATPase subunit alpha-3 OS=Gallus gallus GN=ATP1A3 PE=2 SV=1 33 383 3.0E-50
sp|P13637|AT1A3_HUMAN Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens GN=ATP1A3 PE=1 SV=3 47 383 4.0E-50
sp|P06687|AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus GN=Atp1a3 PE=1 SV=2 47 383 5.0E-50
sp|Q6PIC6|AT1A3_MOUSE Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus GN=Atp1a3 PE=1 SV=1 47 383 5.0E-50
sp|Q6RWA9|AT1A_TAESO Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium PE=2 SV=1 29 383 6.0E-50
sp|P58312|AT1A3_OREMO Sodium/potassium-transporting ATPase subunit alpha-3 OS=Oreochromis mossambicus GN=atp1a3 PE=2 SV=1 60 383 1.0E-49
sp|P24797|AT1A2_CHICK Sodium/potassium-transporting ATPase subunit alpha-2 OS=Gallus gallus GN=ATP1A2 PE=2 SV=1 38 383 2.0E-49
sp|Q64392|AT12A_CAVPO Potassium-transporting ATPase alpha chain 2 OS=Cavia porcellus GN=ATP12A PE=2 SV=1 41 383 2.0E-49
sp|P13607|ATNA_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster GN=Atpalpha PE=1 SV=3 14 383 9.0E-49
sp|P18907|AT1A1_HORSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Equus caballus GN=ATP1A1 PE=3 SV=1 39 383 2.0E-48
sp|P50997|AT1A1_CANLF Sodium/potassium-transporting ATPase subunit alpha-1 OS=Canis lupus familiaris GN=ATP1A1 PE=2 SV=1 28 383 3.0E-48
sp|P05024|AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa GN=ATP1A1 PE=1 SV=1 28 383 3.0E-48
sp|P04074|AT1A1_SHEEP Sodium/potassium-transporting ATPase subunit alpha-1 OS=Ovis aries GN=ATP1A1 PE=1 SV=1 28 383 4.0E-48
sp|Q08DA1|AT1A1_BOVIN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Bos taurus GN=ATP1A1 PE=2 SV=1 28 383 4.0E-48
sp|P35317|AT1A_HYDVU Sodium/potassium-transporting ATPase subunit alpha OS=Hydra vulgaris PE=2 SV=1 31 383 8.0E-48
sp|Q5RDR3|AT1A1_PONAB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Pongo abelii GN=ATP1A1 PE=2 SV=1 49 383 1.0E-47
sp|P05023|AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1 49 383 1.0E-47
sp|D2WKD8|AT1A2_PIG Sodium/potassium-transporting ATPase subunit alpha-2 OS=Sus scrofa GN=ATP1A2 PE=1 SV=1 60 383 3.0E-47
sp|Q5RCD8|AT1A2_PONAB Sodium/potassium-transporting ATPase subunit alpha-2 OS=Pongo abelii GN=ATP1A2 PE=2 SV=1 60 383 3.0E-47
sp|P06686|AT1A2_RAT Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus GN=Atp1a2 PE=1 SV=1 60 383 3.0E-47
sp|Q6PIE5|AT1A2_MOUSE Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus GN=Atp1a2 PE=1 SV=1 60 383 3.0E-47
sp|P50993|AT1A2_HUMAN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens GN=ATP1A2 PE=1 SV=1 60 383 4.0E-47
sp|A2VDL6|AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus GN=ATP1A2 PE=2 SV=1 60 383 5.0E-47
sp|P17326|AT1A_ARTSF Sodium/potassium-transporting ATPase subunit alpha-A OS=Artemia franciscana PE=2 SV=1 56 383 1.0E-46
sp|P30714|AT1A1_RHIMB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rhinella marina GN=ATP1A1 PE=1 SV=2 60 383 2.0E-46
sp|P54708|AT12A_RAT Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus GN=Atp12a PE=1 SV=1 32 383 3.0E-46
sp|Q8VDN2|AT1A1_MOUSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus GN=Atp1a1 PE=1 SV=1 49 383 3.0E-46
sp|P06685|AT1A1_RAT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus GN=Atp1a1 PE=1 SV=1 49 383 3.0E-46
sp|Q9N0Z6|AT1A1_RABIT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oryctolagus cuniculus GN=ATP1A1 PE=1 SV=2 49 383 4.0E-46
sp|P54707|AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens GN=ATP12A PE=1 SV=3 47 383 1.0E-45
sp|P28774|AT1B_ARTSF Sodium/potassium-transporting ATPase subunit alpha-B OS=Artemia franciscana PE=2 SV=1 56 383 1.0E-44
sp|P09572|AT1A1_CHICK Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus GN=ATP1A1 PE=2 SV=1 39 383 1.0E-44
sp|Q92030|AT1A1_ANGAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Anguilla anguilla GN=atp1a1 PE=2 SV=1 56 383 2.0E-43
sp|Q92126|ATP4A_XENLA Potassium-transporting ATPase alpha chain 1 OS=Xenopus laevis GN=atp4a PE=2 SV=3 56 383 2.0E-43
sp|P05025|AT1A_TORCA Sodium/potassium-transporting ATPase subunit alpha OS=Torpedo californica PE=1 SV=1 45 383 2.0E-43
sp|Q9TV52|AT12A_RABIT Potassium-transporting ATPase alpha chain 2 OS=Oryctolagus cuniculus GN=ATP12A PE=2 SV=1 2 383 8.0E-43
sp|Q92123|AT1A1_XENLA Sodium/potassium-transporting ATPase subunit alpha-1 OS=Xenopus laevis GN=atp1a1 PE=2 SV=1 60 383 1.0E-42
sp|Q9YH26|AT1A1_OREMO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oreochromis mossambicus GN=atp1a1 PE=2 SV=2 56 383 1.0E-42
sp|Q64541|AT1A4_RAT Sodium/potassium-transporting ATPase subunit alpha-4 OS=Rattus norvegicus GN=Atp1a4 PE=2 SV=1 60 383 1.0E-42
sp|P50996|ATP4A_CANLF Potassium-transporting ATPase alpha chain 1 OS=Canis lupus familiaris GN=ATP4A PE=2 SV=3 56 383 2.0E-42
sp|P09626|ATP4A_RAT Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus GN=Atp4a PE=1 SV=3 56 383 3.0E-42
sp|P25489|AT1A1_CATCO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Catostomus commersonii GN=atp1a1 PE=2 SV=1 56 383 3.0E-42
sp|Q9WV27|AT1A4_MOUSE Sodium/potassium-transporting ATPase subunit alpha-4 OS=Mus musculus GN=Atp1a4 PE=1 SV=3 60 383 5.0E-42
sp|P20648|ATP4A_HUMAN Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens GN=ATP4A PE=2 SV=5 56 383 5.0E-42
sp|Q9Z1W8|AT12A_MOUSE Potassium-transporting ATPase alpha chain 2 OS=Mus musculus GN=Atp12a PE=1 SV=3 56 383 7.0E-42
sp|P19156|ATP4A_PIG Potassium-transporting ATPase alpha chain 1 OS=Sus scrofa GN=ATP4A PE=1 SV=3 56 383 9.0E-42
sp|Q92036|AT12A_RHIMB Potassium-transporting ATPase alpha chain 2 OS=Rhinella marina GN=ATP12A PE=2 SV=1 49 383 2.0E-41
sp|P27112|ATP4A_RABIT Potassium-transporting ATPase alpha chain 1 OS=Oryctolagus cuniculus GN=ATP4A PE=2 SV=3 56 383 4.0E-41
sp|Q13733|AT1A4_HUMAN Sodium/potassium-transporting ATPase subunit alpha-4 OS=Homo sapiens GN=ATP1A4 PE=1 SV=3 39 383 5.0E-39
sp|Q64436|ATP4A_MOUSE Potassium-transporting ATPase alpha chain 1 OS=Mus musculus GN=Atp4a PE=1 SV=3 56 383 7.0E-39
sp|Q73E41|BACA1_BACC1 Calcium-transporting ATPase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0519 PE=1 SV=1 58 379 7.0E-26
sp|P9WPS9|CTPF_MYCTU Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpF PE=1 SV=1 60 364 2.0E-25
sp|P9WPS8|CTPF_MYCTO Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpF PE=2 SV=1 60 364 2.0E-25
sp|P63688|CTPF_MYCBO Probable cation-transporting ATPase F OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpF PE=3 SV=1 60 364 2.0E-25
sp|Q8R4C1|AT2C2_RAT Calcium-transporting ATPase type 2C member 2 OS=Rattus norvegicus GN=Atp2c2 PE=2 SV=1 65 381 7.0E-25
sp|P37367|ATA1_SYNY3 Cation-transporting ATPase pma1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pma1 PE=3 SV=2 57 379 1.0E-24
sp|A7L9Z8|AT2C2_MOUSE Calcium-transporting ATPase type 2C member 2 OS=Mus musculus GN=Atp2c2 PE=2 SV=1 65 381 2.0E-24
sp|P57709|AT2C1_BOVIN Calcium-transporting ATPase type 2C member 1 OS=Bos taurus GN=ATP2C1 PE=2 SV=1 139 379 6.0E-24
sp|O59868|ATC1_SCHPO Calcium-transporting ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmr1 PE=1 SV=1 133 377 9.0E-24
sp|P98194|AT2C1_HUMAN Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens GN=ATP2C1 PE=1 SV=3 139 379 9.0E-24
sp|Q5R5K5|AT2C1_PONAB Calcium-transporting ATPase type 2C member 1 OS=Pongo abelii GN=ATP2C1 PE=2 SV=1 139 379 9.0E-24
sp|Q9SY55|ECA3_ARATH Calcium-transporting ATPase 3, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA3 PE=2 SV=3 71 381 9.0E-24
sp|Q64566|AT2C1_RAT Calcium-transporting ATPase type 2C member 1 OS=Rattus norvegicus GN=Atp2c1 PE=2 SV=1 77 379 1.0E-23
sp|O43108|ATC1_YARLI Calcium-transporting ATPase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PMR1 PE=3 SV=1 61 378 4.0E-22
sp|Q80XR2|AT2C1_MOUSE Calcium-transporting ATPase type 2C member 1 OS=Mus musculus GN=Atp2c1 PE=1 SV=2 162 379 7.0E-22
sp|O34431|ATCL_BACSU Calcium-transporting ATPase OS=Bacillus subtilis (strain 168) GN=yloB PE=1 SV=1 57 379 9.0E-22
sp|O75185|AT2C2_HUMAN Calcium-transporting ATPase type 2C member 2 OS=Homo sapiens GN=ATP2C2 PE=1 SV=2 162 381 3.0E-21
sp|Q92105|AT2A1_PELES Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Pelophylax esculentus GN=ATP2A1 PE=2 SV=1 60 371 7.0E-21
sp|Q42883|ECAP_SOLLC Calcium-transporting ATPase, endoplasmic reticulum-type OS=Solanum lycopersicum GN=LCA1 PE=2 SV=1 65 383 3.0E-20
sp|P13586|ATC1_YEAST Calcium-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMR1 PE=1 SV=1 62 364 3.0E-20
sp|Q64518|AT2A3_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Mus musculus GN=Atp2a3 PE=1 SV=3 60 371 3.0E-20
sp|Q9XES1|ECA4_ARATH Calcium-transporting ATPase 4, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA4 PE=2 SV=2 69 381 4.0E-20
sp|P92939|ECA1_ARATH Calcium-transporting ATPase 1, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA1 PE=1 SV=2 69 381 7.0E-20
sp|P37278|ATCL_SYNE7 Calcium-transporting ATPase OS=Synechococcus elongatus (strain PCC 7942) GN=pacL PE=1 SV=2 60 371 1.0E-19
sp|P18596|AT2A3_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Rattus norvegicus GN=Atp2a3 PE=1 SV=2 60 371 1.0E-19
sp|Q93084|AT2A3_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Homo sapiens GN=ATP2A3 PE=1 SV=2 60 371 1.0E-19
sp|Q7PPA5|ATC1_ANOGA Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Anopheles gambiae GN=Ca-P60A PE=3 SV=5 60 371 2.0E-19
sp|P70083|AT2A1_MAKNI Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Makaira nigricans GN=atp2a1 PE=2 SV=2 58 371 5.0E-19
sp|O46674|AT2A2_CANLF Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Canis lupus familiaris GN=ATP2A2 PE=2 SV=1 58 371 6.0E-19
sp|P11507|AT2A2_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Rattus norvegicus GN=Atp2a2 PE=1 SV=1 58 371 7.0E-19
sp|P11607|AT2A2_PIG Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Sus scrofa GN=ATP2A2 PE=1 SV=1 58 371 7.0E-19
sp|O55143|AT2A2_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Mus musculus GN=Atp2a2 PE=1 SV=2 58 371 7.0E-19
sp|P20647|AT2A2_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Oryctolagus cuniculus GN=ATP2A2 PE=2 SV=2 58 371 7.0E-19
sp|P16615|AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 58 371 7.0E-19
sp|Q8R429|AT2A1_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Mus musculus GN=Atp2a1 PE=1 SV=1 60 371 9.0E-19
sp|Q9YGL9|AT2A3_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Gallus gallus GN=ATP2A3 PE=2 SV=1 60 371 1.0E-18
sp|Q64578|AT2A1_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Rattus norvegicus GN=Atp2a1 PE=1 SV=1 60 371 1.0E-18
sp|Q00779|AT2A2_FELCA Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Felis catus GN=ATP2A2 PE=2 SV=1 58 371 1.0E-18
sp|Q8Y8Q5|LMCA1_LISMO Calcium-transporting ATPase lmo0841 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0841 PE=1 SV=1 57 364 1.0E-18
sp|P22700|ATC1_DROME Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster GN=Ca-P60A PE=1 SV=2 60 371 2.0E-18
sp|P04191|AT2A1_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Oryctolagus cuniculus GN=ATP2A1 PE=1 SV=1 60 371 3.0E-18
sp|P13585|AT2A1_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Gallus gallus GN=ATP2A1 PE=2 SV=2 58 371 4.0E-18
sp|Q0VCY0|AT2A1_BOVIN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Bos taurus GN=ATP2A1 PE=1 SV=1 60 371 6.0E-18
sp|Q292Q0|ATC1_DROPS Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila pseudoobscura pseudoobscura GN=Ca-P60A PE=3 SV=2 78 371 1.0E-17
sp|Q03669|AT2A2_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Gallus gallus GN=ATP2A2 PE=2 SV=2 58 371 1.0E-17
sp|P54209|ATC1_DUNBI Cation-transporting ATPase CA1 OS=Dunaliella bioculata GN=CA1 PE=2 SV=1 146 378 2.0E-17
sp|O23087|ECA2_ARATH Calcium-transporting ATPase 2, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA2 PE=1 SV=1 65 371 3.0E-17
sp|P13587|ATN1_YEAST Sodium transport ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA1 PE=1 SV=1 60 286 4.0E-17
sp|O14983|AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens GN=ATP2A1 PE=1 SV=1 60 371 6.0E-17
sp|Q12691|ATN5_YEAST Sodium transport ATPase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA5 PE=1 SV=1 42 286 2.0E-16
sp|Q01896|ATN2_YEAST Sodium transport ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA2 PE=1 SV=1 42 286 2.0E-16
sp|P22036|ATMB_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtB PE=1 SV=3 77 383 5.0E-16
sp|Q58623|Y1226_METJA Putative cation-transporting ATPase MJ1226 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1226 PE=3 SV=1 62 364 8.0E-16
sp|P23634|AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2 18 283 1.0E-15
sp|Q9CFU9|LLCA1_LACLA Calcium-transporting ATPase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yoaB PE=1 SV=1 77 364 1.0E-15
sp|D3K0R6|AT2B4_BOVIN Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 11 283 1.0E-15
sp|P35315|ATC_TRYBB Probable calcium-transporting ATPase OS=Trypanosoma brucei brucei GN=TBA1 PE=3 SV=1 71 381 3.0E-15
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 58 371 4.0E-15
sp|P0ABB8|ATMA_ECOLI Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli (strain K12) GN=mgtA PE=1 SV=1 57 383 5.0E-15
sp|P0ABB9|ATMA_ECO57 Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli O157:H7 GN=mgtA PE=3 SV=1 57 383 5.0E-15
sp|P35316|ATC_ARTSF Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Artemia franciscana PE=2 SV=1 60 371 6.0E-15
sp|P47317|ATCL_MYCGE Probable cation-transporting P-type ATPase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pacL PE=3 SV=1 77 377 2.0E-14
sp|P54210|PMA1_DUNAC Plasma membrane ATPase OS=Dunaliella acidophila GN=DHA1 PE=2 SV=1 41 364 6.0E-14
sp|P54211|PMA1_DUNBI Plasma membrane ATPase OS=Dunaliella bioculata GN=PMA1 PE=2 SV=1 44 364 8.0E-14
sp|Q6Q477|AT2B4_MOUSE Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus GN=Atp2b4 PE=1 SV=1 52 283 9.0E-14
sp|P12522|ATXB_LEIDO Probable proton ATPase 1B OS=Leishmania donovani GN=H1B PE=2 SV=1 75 383 1.0E-13
sp|Q64542|AT2B4_RAT Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 52 283 2.0E-13
sp|P78036|ATCL_MYCPN Probable cation-transporting P-type ATPase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pacL PE=3 SV=1 77 377 4.0E-13
sp|P11718|ATXA_LEIDO Probable proton ATPase 1A OS=Leishmania donovani GN=H1A PE=2 SV=2 75 383 5.0E-13
sp|P36640|ATMA_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtA PE=2 SV=1 151 383 9.0E-13
sp|D0ZTB2|ATMA_SALT1 Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=mgtA PE=2 SV=1 151 383 9.0E-13
sp|Q9SH76|PMA6_ARATH ATPase 6, plasma membrane-type OS=Arabidopsis thaliana GN=AHA6 PE=2 SV=1 50 370 1.0E-12
sp|P05030|PMA1_YEAST Plasma membrane ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA1 PE=1 SV=2 69 383 1.0E-12
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 148 283 1.0E-12
sp|Q9R0K7|AT2B2_MOUSE Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus GN=Atp2b2 PE=1 SV=2 148 283 2.0E-12
sp|Q2QY12|ACA4_ORYSJ Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1 148 364 2.0E-12
sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 57 364 2.0E-12
sp|P22189|ATC3_SCHPO Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 77 383 4.0E-12
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 148 283 5.0E-12
sp|P54679|PMA1_DICDI Probable plasma membrane ATPase OS=Dictyostelium discoideum GN=patB PE=2 SV=2 65 364 8.0E-12
sp|P28877|PMA1_CANAX Plasma membrane ATPase 1 OS=Candida albicans GN=PMA1 PE=1 SV=1 21 383 9.0E-12
sp|Q9M2A0|PMA8_ARATH ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=AHA8 PE=3 SV=1 50 370 1.0E-11
sp|P07038|PMA1_NEUCR Plasma membrane ATPase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pma-1 PE=1 SV=1 78 383 1.0E-11
sp|P19657|PMA2_YEAST Plasma membrane ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA2 PE=1 SV=3 69 383 2.0E-11
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 159 283 2.0E-11
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 148 283 2.0E-11
sp|Q64568|AT2B3_RAT Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 148 283 3.0E-11
sp|Q43128|PMA10_ARATH ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=AHA10 PE=2 SV=2 50 364 3.0E-11
sp|Q9LY32|PMA7_ARATH ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=AHA7 PE=2 SV=1 56 383 4.0E-11
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 159 283 5.0E-11
sp|P20431|PMA3_ARATH ATPase 3, plasma membrane-type OS=Arabidopsis thaliana GN=AHA3 PE=1 SV=2 56 370 5.0E-11
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 159 283 5.0E-11
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 159 283 5.0E-11
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 159 283 6.0E-11
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 44 364 6.0E-11
sp|Q08436|PMA3_NICPL Plasma membrane ATPase 3 OS=Nicotiana plumbaginifolia GN=PMA3 PE=1 SV=1 56 370 7.0E-11
sp|P28876|PMA2_SCHPO Plasma membrane ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma2 PE=3 SV=1 71 383 9.0E-11
sp|P22180|PMA1_SOLLC Plasma membrane ATPase 1 OS=Solanum lycopersicum GN=LHA1 PE=2 SV=1 56 370 2.0E-10
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 159 283 4.0E-10
sp|Q9SU58|PMA4_ARATH ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=AHA4 PE=2 SV=2 56 370 4.0E-10
sp|Q9SJB3|PMA5_ARATH ATPase 5, plasma membrane-type OS=Arabidopsis thaliana GN=AHA5 PE=3 SV=3 52 366 5.0E-10
sp|Q08435|PMA1_NICPL Plasma membrane ATPase 1 OS=Nicotiana plumbaginifolia GN=PMA1 PE=2 SV=1 56 370 7.0E-10
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 148 383 7.0E-10
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 162 383 1.0E-09
sp|P24545|PMA1_ZYGRO Plasma membrane ATPase OS=Zygosaccharomyces rouxii PE=3 SV=1 71 383 1.0E-09
sp|Q2QMX9|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1 63 371 1.0E-09
sp|P83970|PMA1_WHEAT Plasma membrane ATPase OS=Triticum aestivum GN=ha1 PE=2 SV=1 57 370 2.0E-09
sp|Q9LV11|PMA11_ARATH ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=AHA11 PE=1 SV=1 77 370 2.0E-09
sp|O81108|ACA2_ARATH Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1 56 371 2.0E-09
sp|Q7XPY2|PMA1_ORYSJ Plasma membrane ATPase OS=Oryza sativa subsp. japonica GN=Os04g0656100 PE=2 SV=1 57 370 3.0E-09
sp|P9WPT3|CTPD_MYCTU Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpD PE=3 SV=1 148 321 9.0E-09
sp|P9WPT2|CTPD_MYCTO Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpD PE=3 SV=1 148 321 9.0E-09
sp|P63686|CTPD_MYCBO Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpD PE=3 SV=1 148 321 9.0E-09
sp|Q03194|PMA4_NICPL Plasma membrane ATPase 4 OS=Nicotiana plumbaginifolia GN=PMA4 PE=2 SV=1 57 370 1.0E-08
sp|P20649|PMA1_ARATH ATPase 1, plasma membrane-type OS=Arabidopsis thaliana GN=AHA1 PE=1 SV=3 56 370 2.0E-08
sp|P19456|PMA2_ARATH ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=AHA2 PE=1 SV=2 56 370 2.0E-08
sp|P49380|PMA1_KLULA Plasma membrane ATPase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PMA1 PE=1 SV=1 69 282 2.0E-08
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 56 371 4.0E-08
sp|Q8RUN1|ACA3_ORYSJ Calcium-transporting ATPase 3, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os01g0939100 PE=2 SV=1 56 383 5.0E-08
sp|O31688|ZOSA_BACSU Zinc-transporting ATPase OS=Bacillus subtilis (strain 168) GN=zosA PE=1 SV=1 145 362 1.0E-07
sp|Q8CN02|COPA_STAES Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1 145 336 2.0E-07
sp|Q5HL56|COPA_STAEQ Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1 145 336 2.0E-07
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 145 364 2.0E-07
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 141 383 2.0E-07
sp|Q9T0E0|PMAX_ARATH Putative ATPase, plasma membrane-like OS=Arabidopsis thaliana GN=At4g11730 PE=3 SV=1 58 366 2.0E-07
sp|Q42556|PMA9_ARATH ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=AHA9 PE=2 SV=2 57 370 2.0E-07
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 141 383 5.0E-07
sp|Q6ATV4|ACA2_ORYSJ Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1 185 371 8.0E-07
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 58 383 9.0E-07
sp|Q4L970|COPA_STAHJ Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 168 336 9.0E-07
sp|O53114|CTPI_MYCLE Probable cation-transporting ATPase I OS=Mycobacterium leprae (strain TN) GN=ctpI PE=3 SV=1 194 382 9.0E-07
sp|Q07421|PMA1_AJECA Plasma membrane ATPase OS=Ajellomyces capsulatus GN=PMA1 PE=3 SV=1 78 276 1.0E-06
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 194 382 1.0E-06
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 194 382 1.0E-06
sp|P38929|ATC2_YEAST Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 79 383 2.0E-06
sp|Q4A0G1|COPA_STAS1 Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1 165 347 3.0E-06
sp|P37617|ATZN_ECOLI Lead, cadmium, zinc and mercury-transporting ATPase OS=Escherichia coli (strain K12) GN=zntA PE=1 SV=1 139 307 3.0E-06
sp|P32113|COPA_ENTHA Probable copper-importing P-type ATPase A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copA PE=1 SV=2 147 330 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 107 129 22
2 139 161 22
3 305 327 22
4 342 364 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6087
LPPTSPYSGVPIEYRTLSSHVAESRNADADADADAAPGGADAKATVRRDDQDYFANLNLHELGADQLCQQLNVAP
GSGLSESAAANRLRRDGANTLPRAKTNYGRKVFGYVFGGFCSVLWVGVIIFFLCWRPLSNPPSATNLALAILILI
VIALQAGFSAFQDWSTQRTMRSITDLLPSEALAVREGRPRRLPASQLVSGDVVQLRAGDKVPADLRLLSHSGDIR
FDRAVLTGESDEVEGAVDATDANFLESRNVALMGTLVVNGSGVGVVVLTGPRSVMGRIARATATAGERPTLIQRE
IWRFVRIIVALTVVLALLILLTWALWLRRDHPGYMDVVAMLNNVMGCVVAFIPEGMPVAVALTLMTVARHMKAVS
ILPKGLRAP*
Coding >Hirsu2|6087
CTGCCGCCGACGTCGCCCTACTCGGGCGTGCCGATCGAGTACCGCACCCTGTCCAGCCACGTGGCCGAGTCGCGC
AACGCCGACGCCGACGCCGACGCCGACGCGGCCCCGGGCGGCGCCGACGCCAAGGCCACCGTCCGCCGGGACGAC
CAGGACTACTTCGCCAACCTCAACCTCCACGAGCTGGGCGCCGACCAGCTGTGCCAGCAGCTCAACGTGGCGCCC
GGCTCCGGCCTGTCGGAGAGCGCGGCCGCGAACCGGCTGCGGCGCGACGGCGCCAACACGCTGCCGCGGGCCAAG
ACCAACTACGGCCGCAAGGTCTTCGGCTACGTCTTCGGCGGCTTCTGCTCCGTCCTCTGGGTCGGCGTCATCATC
TTCTTCCTCTGCTGGCGGCCGCTCAGCAACCCGCCCTCGGCCACGAACCTGGCGCTCGCCATCCTGATCCTCATC
GTCATCGCGCTGCAGGCCGGCTTCTCGGCCTTCCAGGACTGGTCGACGCAGCGGACGATGCGGTCCATCACGGAC
CTGCTGCCGTCCGAGGCGCTGGCCGTGCGCGAGGGCCGCCCGCGCCGGCTGCCGGCCTCGCAGCTCGTCAGCGGC
GACGTCGTCCAGCTCCGCGCCGGCGACAAGGTGCCGGCCGACCTGCGCCTGCTGAGCCACTCGGGCGACATCCGC
TTCGACCGCGCCGTGCTGACGGGCGAGTCGGACGAGGTCGAGGGCGCCGTCGACGCCACCGACGCCAACTTCCTC
GAGAGCCGCAACGTGGCGCTCATGGGCACCCTGGTCGTCAACGGCTCCGGCGTCGGCGTCGTCGTCCTGACGGGC
CCGCGCTCCGTCATGGGCCGCATCGCCCGCGCCACCGCCACGGCCGGCGAGCGCCCGACGCTGATCCAGCGCGAG
ATCTGGCGCTTCGTCCGCATCATCGTCGCCCTGACCGTCGTCCTCGCCCTGCTGATCCTGCTGACCTGGGCCCTG
TGGCTGCGCCGCGACCACCCGGGCTACATGGACGTCGTCGCCATGCTCAACAACGTCATGGGCTGCGTCGTCGCC
TTCATCCCCGAGGGCATGCCCGTCGCCGTGGCCCTGACGCTGATGACCGTCGCCCGCCACATGAAGGCCGTCAGC
ATCCTGCCCAAGGGGCTACGGGCACCCTGA
Transcript >Hirsu2|6087
CTGCCGCCGACGTCGCCCTACTCGGGCGTGCCGATCGAGTACCGCACCCTGTCCAGCCACGTGGCCGAGTCGCGC
AACGCCGACGCCGACGCCGACGCCGACGCGGCCCCGGGCGGCGCCGACGCCAAGGCCACCGTCCGCCGGGACGAC
CAGGACTACTTCGCCAACCTCAACCTCCACGAGCTGGGCGCCGACCAGCTGTGCCAGCAGCTCAACGTGGCGCCC
GGCTCCGGCCTGTCGGAGAGCGCGGCCGCGAACCGGCTGCGGCGCGACGGCGCCAACACGCTGCCGCGGGCCAAG
ACCAACTACGGCCGCAAGGTCTTCGGCTACGTCTTCGGCGGCTTCTGCTCCGTCCTCTGGGTCGGCGTCATCATC
TTCTTCCTCTGCTGGCGGCCGCTCAGCAACCCGCCCTCGGCCACGAACCTGGCGCTCGCCATCCTGATCCTCATC
GTCATCGCGCTGCAGGCCGGCTTCTCGGCCTTCCAGGACTGGTCGACGCAGCGGACGATGCGGTCCATCACGGAC
CTGCTGCCGTCCGAGGCGCTGGCCGTGCGCGAGGGCCGCCCGCGCCGGCTGCCGGCCTCGCAGCTCGTCAGCGGC
GACGTCGTCCAGCTCCGCGCCGGCGACAAGGTGCCGGCCGACCTGCGCCTGCTGAGCCACTCGGGCGACATCCGC
TTCGACCGCGCCGTGCTGACGGGCGAGTCGGACGAGGTCGAGGGCGCCGTCGACGCCACCGACGCCAACTTCCTC
GAGAGCCGCAACGTGGCGCTCATGGGCACCCTGGTCGTCAACGGCTCCGGCGTCGGCGTCGTCGTCCTGACGGGC
CCGCGCTCCGTCATGGGCCGCATCGCCCGCGCCACCGCCACGGCCGGCGAGCGCCCGACGCTGATCCAGCGCGAG
ATCTGGCGCTTCGTCCGCATCATCGTCGCCCTGACCGTCGTCCTCGCCCTGCTGATCCTGCTGACCTGGGCCCTG
TGGCTGCGCCGCGACCACCCGGGCTACATGGACGTCGTCGCCATGCTCAACAACGTCATGGGCTGCGTCGTCGCC
TTCATCCCCGAGGGCATGCCCGTCGCCGTGGCCCTGACGCTGATGACCGTCGCCCGCCACATGAAGGCCGTCAGC
ATCCTGCCCAAGGGGCTACGGGCACCCTGA
Gene >Hirsu2|6087
CTGCCGCCGACGTCGCCCTACTCGGGCGTGCCGATCGAGTACCGCACCCTGTCCAGCCACGTGGCCGAGTCGCGC
AACGCCGACGCCGACGCCGACGCCGACGCGGCCCCGGGCGGCGCCGACGCCAAGGCCACCGTCCGCCGGGACGAC
CAGGACTACTTCGCCAACCTCAACCTCCACGAGCTGGGCGCCGACCAGCTGTGCCAGCAGCTCAACGTGGCGCCC
GGCTCCGGCCTGTCGGAGAGCGCGGCCGCGAACCGGCTGCGGCGCGACGGCGCCAACACGCTGCCGCGGGCCAAG
ACCAACTACGGCCGCAAGGTCTTCGGCTACGTCTTCGGCGGCTTCTGCTCCGTCCTCTGGGTCGGCGTCATCATC
TTCTTCCTCTGCTGGCGGCCGCTCAGCAACCCGCCCTCGGCCACGAACCTGGCGCTCGCCATCCTGATCCTCATC
GTCATCGCGCTGCAGGCCGGCTTCTCGGCCTTCCAGGACTGGTCGACGCAGCGGACGATGCGGTCCATCACGGAC
CTGCTGCCGTCCGAGGCGCTGGCCGTGCGCGAGGGCCGCCCGCGCCGGCTGCCGGCCTCGCAGCTCGTCAGCGGC
GACGTCGTCCAGCTCCGCGCCGGCGACAAGGTGCCGGCCGACCTGCGCCTGCTGAGCCACTCGGGCGACATCCGC
TTCGACCGCGCCGTGCTGACGGGCGAGTCGGACGAGGTCGAGGGCGCCGTCGACGCCACCGACGCCAACTTCCTC
GAGAGCCGCAACGTGGCGCTCATGGGCACCCTGGTCGTCAACGGCTCCGGCGTCGGCGTCGTCGTCCTGACGGGC
CCGCGCTCCGTCATGGGCCGCATCGCCCGCGCCACCGCCACGGCCGGCGAGCGCCCGACGCTGATCCAGCGCGAG
ATCTGGCGCTTCGTCCGCATCATCGTCGCCCTGACCGTCGTCCTCGCCCTGCTGATCCTGCTGACCTGGGCCCTG
TGGCTGCGCCGCGACCACCCGGGCTACATGGACGTCGTCGCCATGCTCAACAACGTCATGGGCTGCGTCGTCGCC
TTCATCCCCGAGGGCATGCCCGTCGCCGTGGCCCTGACGCTGATGACCGTCGCCCGCCACATGAAGGCCGTCAGC
ATCCTGCCCAAGGGGCTGTCGACGGTCGAGACGCTCGGCTGCGTCGACGTCATCTGCTCCGACAAGACGGGCACC
CTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail