© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|6087 |
| Gene name | |
| Location | Contig_3082:33..1237 |
| Strand | + |
| Gene length (bp) | 1204 |
| Transcript length (bp) | 1155 |
| Coding sequence length (bp) | 1155 |
| Protein length (aa) | 385 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00122 | E1-E2_ATPase | E1-E2 ATPase | 1.1E-38 | 176 | 372 |
| PF00690 | Cation_ATPase_N | Cation transporter/ATPase, N-terminus | 1.6E-10 | 60 | 125 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P24798|AT1A3_CHICK | Sodium/potassium-transporting ATPase subunit alpha-3 OS=Gallus gallus GN=ATP1A3 PE=2 SV=1 | 33 | 383 | 3.0E-50 |
| sp|P13637|AT1A3_HUMAN | Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens GN=ATP1A3 PE=1 SV=3 | 47 | 383 | 4.0E-50 |
| sp|P06687|AT1A3_RAT | Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus GN=Atp1a3 PE=1 SV=2 | 47 | 383 | 5.0E-50 |
| sp|Q6PIC6|AT1A3_MOUSE | Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus GN=Atp1a3 PE=1 SV=1 | 47 | 383 | 5.0E-50 |
| sp|Q6RWA9|AT1A_TAESO | Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium PE=2 SV=1 | 29 | 383 | 6.0E-50 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P24798|AT1A3_CHICK | Sodium/potassium-transporting ATPase subunit alpha-3 OS=Gallus gallus GN=ATP1A3 PE=2 SV=1 | 33 | 383 | 3.0E-50 |
| sp|P13637|AT1A3_HUMAN | Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens GN=ATP1A3 PE=1 SV=3 | 47 | 383 | 4.0E-50 |
| sp|P06687|AT1A3_RAT | Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus GN=Atp1a3 PE=1 SV=2 | 47 | 383 | 5.0E-50 |
| sp|Q6PIC6|AT1A3_MOUSE | Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus GN=Atp1a3 PE=1 SV=1 | 47 | 383 | 5.0E-50 |
| sp|Q6RWA9|AT1A_TAESO | Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium PE=2 SV=1 | 29 | 383 | 6.0E-50 |
| sp|P58312|AT1A3_OREMO | Sodium/potassium-transporting ATPase subunit alpha-3 OS=Oreochromis mossambicus GN=atp1a3 PE=2 SV=1 | 60 | 383 | 1.0E-49 |
| sp|P24797|AT1A2_CHICK | Sodium/potassium-transporting ATPase subunit alpha-2 OS=Gallus gallus GN=ATP1A2 PE=2 SV=1 | 38 | 383 | 2.0E-49 |
| sp|Q64392|AT12A_CAVPO | Potassium-transporting ATPase alpha chain 2 OS=Cavia porcellus GN=ATP12A PE=2 SV=1 | 41 | 383 | 2.0E-49 |
| sp|P13607|ATNA_DROME | Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster GN=Atpalpha PE=1 SV=3 | 14 | 383 | 9.0E-49 |
| sp|P18907|AT1A1_HORSE | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Equus caballus GN=ATP1A1 PE=3 SV=1 | 39 | 383 | 2.0E-48 |
| sp|P50997|AT1A1_CANLF | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Canis lupus familiaris GN=ATP1A1 PE=2 SV=1 | 28 | 383 | 3.0E-48 |
| sp|P05024|AT1A1_PIG | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa GN=ATP1A1 PE=1 SV=1 | 28 | 383 | 3.0E-48 |
| sp|P04074|AT1A1_SHEEP | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Ovis aries GN=ATP1A1 PE=1 SV=1 | 28 | 383 | 4.0E-48 |
| sp|Q08DA1|AT1A1_BOVIN | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Bos taurus GN=ATP1A1 PE=2 SV=1 | 28 | 383 | 4.0E-48 |
| sp|P35317|AT1A_HYDVU | Sodium/potassium-transporting ATPase subunit alpha OS=Hydra vulgaris PE=2 SV=1 | 31 | 383 | 8.0E-48 |
| sp|Q5RDR3|AT1A1_PONAB | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Pongo abelii GN=ATP1A1 PE=2 SV=1 | 49 | 383 | 1.0E-47 |
| sp|P05023|AT1A1_HUMAN | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1 | 49 | 383 | 1.0E-47 |
| sp|D2WKD8|AT1A2_PIG | Sodium/potassium-transporting ATPase subunit alpha-2 OS=Sus scrofa GN=ATP1A2 PE=1 SV=1 | 60 | 383 | 3.0E-47 |
| sp|Q5RCD8|AT1A2_PONAB | Sodium/potassium-transporting ATPase subunit alpha-2 OS=Pongo abelii GN=ATP1A2 PE=2 SV=1 | 60 | 383 | 3.0E-47 |
| sp|P06686|AT1A2_RAT | Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus GN=Atp1a2 PE=1 SV=1 | 60 | 383 | 3.0E-47 |
| sp|Q6PIE5|AT1A2_MOUSE | Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus GN=Atp1a2 PE=1 SV=1 | 60 | 383 | 3.0E-47 |
| sp|P50993|AT1A2_HUMAN | Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens GN=ATP1A2 PE=1 SV=1 | 60 | 383 | 4.0E-47 |
| sp|A2VDL6|AT1A2_BOVIN | Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus GN=ATP1A2 PE=2 SV=1 | 60 | 383 | 5.0E-47 |
| sp|P17326|AT1A_ARTSF | Sodium/potassium-transporting ATPase subunit alpha-A OS=Artemia franciscana PE=2 SV=1 | 56 | 383 | 1.0E-46 |
| sp|P30714|AT1A1_RHIMB | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rhinella marina GN=ATP1A1 PE=1 SV=2 | 60 | 383 | 2.0E-46 |
| sp|P54708|AT12A_RAT | Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus GN=Atp12a PE=1 SV=1 | 32 | 383 | 3.0E-46 |
| sp|Q8VDN2|AT1A1_MOUSE | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus GN=Atp1a1 PE=1 SV=1 | 49 | 383 | 3.0E-46 |
| sp|P06685|AT1A1_RAT | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus GN=Atp1a1 PE=1 SV=1 | 49 | 383 | 3.0E-46 |
| sp|Q9N0Z6|AT1A1_RABIT | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oryctolagus cuniculus GN=ATP1A1 PE=1 SV=2 | 49 | 383 | 4.0E-46 |
| sp|P54707|AT12A_HUMAN | Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens GN=ATP12A PE=1 SV=3 | 47 | 383 | 1.0E-45 |
| sp|P28774|AT1B_ARTSF | Sodium/potassium-transporting ATPase subunit alpha-B OS=Artemia franciscana PE=2 SV=1 | 56 | 383 | 1.0E-44 |
| sp|P09572|AT1A1_CHICK | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus GN=ATP1A1 PE=2 SV=1 | 39 | 383 | 1.0E-44 |
| sp|Q92030|AT1A1_ANGAN | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Anguilla anguilla GN=atp1a1 PE=2 SV=1 | 56 | 383 | 2.0E-43 |
| sp|Q92126|ATP4A_XENLA | Potassium-transporting ATPase alpha chain 1 OS=Xenopus laevis GN=atp4a PE=2 SV=3 | 56 | 383 | 2.0E-43 |
| sp|P05025|AT1A_TORCA | Sodium/potassium-transporting ATPase subunit alpha OS=Torpedo californica PE=1 SV=1 | 45 | 383 | 2.0E-43 |
| sp|Q9TV52|AT12A_RABIT | Potassium-transporting ATPase alpha chain 2 OS=Oryctolagus cuniculus GN=ATP12A PE=2 SV=1 | 2 | 383 | 8.0E-43 |
| sp|Q92123|AT1A1_XENLA | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Xenopus laevis GN=atp1a1 PE=2 SV=1 | 60 | 383 | 1.0E-42 |
| sp|Q9YH26|AT1A1_OREMO | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oreochromis mossambicus GN=atp1a1 PE=2 SV=2 | 56 | 383 | 1.0E-42 |
| sp|Q64541|AT1A4_RAT | Sodium/potassium-transporting ATPase subunit alpha-4 OS=Rattus norvegicus GN=Atp1a4 PE=2 SV=1 | 60 | 383 | 1.0E-42 |
| sp|P50996|ATP4A_CANLF | Potassium-transporting ATPase alpha chain 1 OS=Canis lupus familiaris GN=ATP4A PE=2 SV=3 | 56 | 383 | 2.0E-42 |
| sp|P09626|ATP4A_RAT | Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus GN=Atp4a PE=1 SV=3 | 56 | 383 | 3.0E-42 |
| sp|P25489|AT1A1_CATCO | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Catostomus commersonii GN=atp1a1 PE=2 SV=1 | 56 | 383 | 3.0E-42 |
| sp|Q9WV27|AT1A4_MOUSE | Sodium/potassium-transporting ATPase subunit alpha-4 OS=Mus musculus GN=Atp1a4 PE=1 SV=3 | 60 | 383 | 5.0E-42 |
| sp|P20648|ATP4A_HUMAN | Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens GN=ATP4A PE=2 SV=5 | 56 | 383 | 5.0E-42 |
| sp|Q9Z1W8|AT12A_MOUSE | Potassium-transporting ATPase alpha chain 2 OS=Mus musculus GN=Atp12a PE=1 SV=3 | 56 | 383 | 7.0E-42 |
| sp|P19156|ATP4A_PIG | Potassium-transporting ATPase alpha chain 1 OS=Sus scrofa GN=ATP4A PE=1 SV=3 | 56 | 383 | 9.0E-42 |
| sp|Q92036|AT12A_RHIMB | Potassium-transporting ATPase alpha chain 2 OS=Rhinella marina GN=ATP12A PE=2 SV=1 | 49 | 383 | 2.0E-41 |
| sp|P27112|ATP4A_RABIT | Potassium-transporting ATPase alpha chain 1 OS=Oryctolagus cuniculus GN=ATP4A PE=2 SV=3 | 56 | 383 | 4.0E-41 |
| sp|Q13733|AT1A4_HUMAN | Sodium/potassium-transporting ATPase subunit alpha-4 OS=Homo sapiens GN=ATP1A4 PE=1 SV=3 | 39 | 383 | 5.0E-39 |
| sp|Q64436|ATP4A_MOUSE | Potassium-transporting ATPase alpha chain 1 OS=Mus musculus GN=Atp4a PE=1 SV=3 | 56 | 383 | 7.0E-39 |
| sp|Q73E41|BACA1_BACC1 | Calcium-transporting ATPase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0519 PE=1 SV=1 | 58 | 379 | 7.0E-26 |
| sp|P9WPS9|CTPF_MYCTU | Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpF PE=1 SV=1 | 60 | 364 | 2.0E-25 |
| sp|P9WPS8|CTPF_MYCTO | Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpF PE=2 SV=1 | 60 | 364 | 2.0E-25 |
| sp|P63688|CTPF_MYCBO | Probable cation-transporting ATPase F OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpF PE=3 SV=1 | 60 | 364 | 2.0E-25 |
| sp|Q8R4C1|AT2C2_RAT | Calcium-transporting ATPase type 2C member 2 OS=Rattus norvegicus GN=Atp2c2 PE=2 SV=1 | 65 | 381 | 7.0E-25 |
| sp|P37367|ATA1_SYNY3 | Cation-transporting ATPase pma1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pma1 PE=3 SV=2 | 57 | 379 | 1.0E-24 |
| sp|A7L9Z8|AT2C2_MOUSE | Calcium-transporting ATPase type 2C member 2 OS=Mus musculus GN=Atp2c2 PE=2 SV=1 | 65 | 381 | 2.0E-24 |
| sp|P57709|AT2C1_BOVIN | Calcium-transporting ATPase type 2C member 1 OS=Bos taurus GN=ATP2C1 PE=2 SV=1 | 139 | 379 | 6.0E-24 |
| sp|O59868|ATC1_SCHPO | Calcium-transporting ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmr1 PE=1 SV=1 | 133 | 377 | 9.0E-24 |
| sp|P98194|AT2C1_HUMAN | Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens GN=ATP2C1 PE=1 SV=3 | 139 | 379 | 9.0E-24 |
| sp|Q5R5K5|AT2C1_PONAB | Calcium-transporting ATPase type 2C member 1 OS=Pongo abelii GN=ATP2C1 PE=2 SV=1 | 139 | 379 | 9.0E-24 |
| sp|Q9SY55|ECA3_ARATH | Calcium-transporting ATPase 3, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA3 PE=2 SV=3 | 71 | 381 | 9.0E-24 |
| sp|Q64566|AT2C1_RAT | Calcium-transporting ATPase type 2C member 1 OS=Rattus norvegicus GN=Atp2c1 PE=2 SV=1 | 77 | 379 | 1.0E-23 |
| sp|O43108|ATC1_YARLI | Calcium-transporting ATPase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PMR1 PE=3 SV=1 | 61 | 378 | 4.0E-22 |
| sp|Q80XR2|AT2C1_MOUSE | Calcium-transporting ATPase type 2C member 1 OS=Mus musculus GN=Atp2c1 PE=1 SV=2 | 162 | 379 | 7.0E-22 |
| sp|O34431|ATCL_BACSU | Calcium-transporting ATPase OS=Bacillus subtilis (strain 168) GN=yloB PE=1 SV=1 | 57 | 379 | 9.0E-22 |
| sp|O75185|AT2C2_HUMAN | Calcium-transporting ATPase type 2C member 2 OS=Homo sapiens GN=ATP2C2 PE=1 SV=2 | 162 | 381 | 3.0E-21 |
| sp|Q92105|AT2A1_PELES | Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Pelophylax esculentus GN=ATP2A1 PE=2 SV=1 | 60 | 371 | 7.0E-21 |
| sp|Q42883|ECAP_SOLLC | Calcium-transporting ATPase, endoplasmic reticulum-type OS=Solanum lycopersicum GN=LCA1 PE=2 SV=1 | 65 | 383 | 3.0E-20 |
| sp|P13586|ATC1_YEAST | Calcium-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMR1 PE=1 SV=1 | 62 | 364 | 3.0E-20 |
| sp|Q64518|AT2A3_MOUSE | Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Mus musculus GN=Atp2a3 PE=1 SV=3 | 60 | 371 | 3.0E-20 |
| sp|Q9XES1|ECA4_ARATH | Calcium-transporting ATPase 4, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA4 PE=2 SV=2 | 69 | 381 | 4.0E-20 |
| sp|P92939|ECA1_ARATH | Calcium-transporting ATPase 1, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA1 PE=1 SV=2 | 69 | 381 | 7.0E-20 |
| sp|P37278|ATCL_SYNE7 | Calcium-transporting ATPase OS=Synechococcus elongatus (strain PCC 7942) GN=pacL PE=1 SV=2 | 60 | 371 | 1.0E-19 |
| sp|P18596|AT2A3_RAT | Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Rattus norvegicus GN=Atp2a3 PE=1 SV=2 | 60 | 371 | 1.0E-19 |
| sp|Q93084|AT2A3_HUMAN | Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Homo sapiens GN=ATP2A3 PE=1 SV=2 | 60 | 371 | 1.0E-19 |
| sp|Q7PPA5|ATC1_ANOGA | Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Anopheles gambiae GN=Ca-P60A PE=3 SV=5 | 60 | 371 | 2.0E-19 |
| sp|P70083|AT2A1_MAKNI | Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Makaira nigricans GN=atp2a1 PE=2 SV=2 | 58 | 371 | 5.0E-19 |
| sp|O46674|AT2A2_CANLF | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Canis lupus familiaris GN=ATP2A2 PE=2 SV=1 | 58 | 371 | 6.0E-19 |
| sp|P11507|AT2A2_RAT | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Rattus norvegicus GN=Atp2a2 PE=1 SV=1 | 58 | 371 | 7.0E-19 |
| sp|P11607|AT2A2_PIG | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Sus scrofa GN=ATP2A2 PE=1 SV=1 | 58 | 371 | 7.0E-19 |
| sp|O55143|AT2A2_MOUSE | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Mus musculus GN=Atp2a2 PE=1 SV=2 | 58 | 371 | 7.0E-19 |
| sp|P20647|AT2A2_RABIT | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Oryctolagus cuniculus GN=ATP2A2 PE=2 SV=2 | 58 | 371 | 7.0E-19 |
| sp|P16615|AT2A2_HUMAN | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 | 58 | 371 | 7.0E-19 |
| sp|Q8R429|AT2A1_MOUSE | Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Mus musculus GN=Atp2a1 PE=1 SV=1 | 60 | 371 | 9.0E-19 |
| sp|Q9YGL9|AT2A3_CHICK | Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Gallus gallus GN=ATP2A3 PE=2 SV=1 | 60 | 371 | 1.0E-18 |
| sp|Q64578|AT2A1_RAT | Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Rattus norvegicus GN=Atp2a1 PE=1 SV=1 | 60 | 371 | 1.0E-18 |
| sp|Q00779|AT2A2_FELCA | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Felis catus GN=ATP2A2 PE=2 SV=1 | 58 | 371 | 1.0E-18 |
| sp|Q8Y8Q5|LMCA1_LISMO | Calcium-transporting ATPase lmo0841 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0841 PE=1 SV=1 | 57 | 364 | 1.0E-18 |
| sp|P22700|ATC1_DROME | Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster GN=Ca-P60A PE=1 SV=2 | 60 | 371 | 2.0E-18 |
| sp|P04191|AT2A1_RABIT | Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Oryctolagus cuniculus GN=ATP2A1 PE=1 SV=1 | 60 | 371 | 3.0E-18 |
| sp|P13585|AT2A1_CHICK | Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Gallus gallus GN=ATP2A1 PE=2 SV=2 | 58 | 371 | 4.0E-18 |
| sp|Q0VCY0|AT2A1_BOVIN | Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Bos taurus GN=ATP2A1 PE=1 SV=1 | 60 | 371 | 6.0E-18 |
| sp|Q292Q0|ATC1_DROPS | Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila pseudoobscura pseudoobscura GN=Ca-P60A PE=3 SV=2 | 78 | 371 | 1.0E-17 |
| sp|Q03669|AT2A2_CHICK | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Gallus gallus GN=ATP2A2 PE=2 SV=2 | 58 | 371 | 1.0E-17 |
| sp|P54209|ATC1_DUNBI | Cation-transporting ATPase CA1 OS=Dunaliella bioculata GN=CA1 PE=2 SV=1 | 146 | 378 | 2.0E-17 |
| sp|O23087|ECA2_ARATH | Calcium-transporting ATPase 2, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA2 PE=1 SV=1 | 65 | 371 | 3.0E-17 |
| sp|P13587|ATN1_YEAST | Sodium transport ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA1 PE=1 SV=1 | 60 | 286 | 4.0E-17 |
| sp|O14983|AT2A1_HUMAN | Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens GN=ATP2A1 PE=1 SV=1 | 60 | 371 | 6.0E-17 |
| sp|Q12691|ATN5_YEAST | Sodium transport ATPase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA5 PE=1 SV=1 | 42 | 286 | 2.0E-16 |
| sp|Q01896|ATN2_YEAST | Sodium transport ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA2 PE=1 SV=1 | 42 | 286 | 2.0E-16 |
| sp|P22036|ATMB_SALTY | Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtB PE=1 SV=3 | 77 | 383 | 5.0E-16 |
| sp|Q58623|Y1226_METJA | Putative cation-transporting ATPase MJ1226 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1226 PE=3 SV=1 | 62 | 364 | 8.0E-16 |
| sp|P23634|AT2B4_HUMAN | Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2 | 18 | 283 | 1.0E-15 |
| sp|Q9CFU9|LLCA1_LACLA | Calcium-transporting ATPase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yoaB PE=1 SV=1 | 77 | 364 | 1.0E-15 |
| sp|D3K0R6|AT2B4_BOVIN | Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 | 11 | 283 | 1.0E-15 |
| sp|P35315|ATC_TRYBB | Probable calcium-transporting ATPase OS=Trypanosoma brucei brucei GN=TBA1 PE=3 SV=1 | 71 | 381 | 3.0E-15 |
| sp|Q08853|ATC_PLAFK | Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 | 58 | 371 | 4.0E-15 |
| sp|P0ABB8|ATMA_ECOLI | Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli (strain K12) GN=mgtA PE=1 SV=1 | 57 | 383 | 5.0E-15 |
| sp|P0ABB9|ATMA_ECO57 | Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli O157:H7 GN=mgtA PE=3 SV=1 | 57 | 383 | 5.0E-15 |
| sp|P35316|ATC_ARTSF | Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Artemia franciscana PE=2 SV=1 | 60 | 371 | 6.0E-15 |
| sp|P47317|ATCL_MYCGE | Probable cation-transporting P-type ATPase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pacL PE=3 SV=1 | 77 | 377 | 2.0E-14 |
| sp|P54210|PMA1_DUNAC | Plasma membrane ATPase OS=Dunaliella acidophila GN=DHA1 PE=2 SV=1 | 41 | 364 | 6.0E-14 |
| sp|P54211|PMA1_DUNBI | Plasma membrane ATPase OS=Dunaliella bioculata GN=PMA1 PE=2 SV=1 | 44 | 364 | 8.0E-14 |
| sp|Q6Q477|AT2B4_MOUSE | Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus GN=Atp2b4 PE=1 SV=1 | 52 | 283 | 9.0E-14 |
| sp|P12522|ATXB_LEIDO | Probable proton ATPase 1B OS=Leishmania donovani GN=H1B PE=2 SV=1 | 75 | 383 | 1.0E-13 |
| sp|Q64542|AT2B4_RAT | Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 | 52 | 283 | 2.0E-13 |
| sp|P78036|ATCL_MYCPN | Probable cation-transporting P-type ATPase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pacL PE=3 SV=1 | 77 | 377 | 4.0E-13 |
| sp|P11718|ATXA_LEIDO | Probable proton ATPase 1A OS=Leishmania donovani GN=H1A PE=2 SV=2 | 75 | 383 | 5.0E-13 |
| sp|P36640|ATMA_SALTY | Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtA PE=2 SV=1 | 151 | 383 | 9.0E-13 |
| sp|D0ZTB2|ATMA_SALT1 | Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=mgtA PE=2 SV=1 | 151 | 383 | 9.0E-13 |
| sp|Q9SH76|PMA6_ARATH | ATPase 6, plasma membrane-type OS=Arabidopsis thaliana GN=AHA6 PE=2 SV=1 | 50 | 370 | 1.0E-12 |
| sp|P05030|PMA1_YEAST | Plasma membrane ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA1 PE=1 SV=2 | 69 | 383 | 1.0E-12 |
| sp|P11506|AT2B2_RAT | Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 | 148 | 283 | 1.0E-12 |
| sp|Q9R0K7|AT2B2_MOUSE | Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus GN=Atp2b2 PE=1 SV=2 | 148 | 283 | 2.0E-12 |
| sp|Q2QY12|ACA4_ORYSJ | Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1 | 148 | 364 | 2.0E-12 |
| sp|Q2RAS0|ACA5_ORYSJ | Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 | 57 | 364 | 2.0E-12 |
| sp|P22189|ATC3_SCHPO | Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 | 77 | 383 | 4.0E-12 |
| sp|Q01814|AT2B2_HUMAN | Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 | 148 | 283 | 5.0E-12 |
| sp|P54679|PMA1_DICDI | Probable plasma membrane ATPase OS=Dictyostelium discoideum GN=patB PE=2 SV=2 | 65 | 364 | 8.0E-12 |
| sp|P28877|PMA1_CANAX | Plasma membrane ATPase 1 OS=Candida albicans GN=PMA1 PE=1 SV=1 | 21 | 383 | 9.0E-12 |
| sp|Q9M2A0|PMA8_ARATH | ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=AHA8 PE=3 SV=1 | 50 | 370 | 1.0E-11 |
| sp|P07038|PMA1_NEUCR | Plasma membrane ATPase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pma-1 PE=1 SV=1 | 78 | 383 | 1.0E-11 |
| sp|P19657|PMA2_YEAST | Plasma membrane ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA2 PE=1 SV=3 | 69 | 383 | 2.0E-11 |
| sp|Q00804|AT2B1_RABIT | Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 | 159 | 283 | 2.0E-11 |
| sp|Q16720|AT2B3_HUMAN | Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 | 148 | 283 | 2.0E-11 |
| sp|Q64568|AT2B3_RAT | Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 | 148 | 283 | 3.0E-11 |
| sp|Q43128|PMA10_ARATH | ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=AHA10 PE=2 SV=2 | 50 | 364 | 3.0E-11 |
| sp|Q9LY32|PMA7_ARATH | ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=AHA7 PE=2 SV=1 | 56 | 383 | 4.0E-11 |
| sp|P20020|AT2B1_HUMAN | Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 | 159 | 283 | 5.0E-11 |
| sp|P20431|PMA3_ARATH | ATPase 3, plasma membrane-type OS=Arabidopsis thaliana GN=AHA3 PE=1 SV=2 | 56 | 370 | 5.0E-11 |
| sp|G5E829|AT2B1_MOUSE | Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 | 159 | 283 | 5.0E-11 |
| sp|P11505|AT2B1_RAT | Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 | 159 | 283 | 5.0E-11 |
| sp|P23220|AT2B1_PIG | Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 | 159 | 283 | 6.0E-11 |
| sp|O22218|ACA4_ARATH | Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 | 44 | 364 | 6.0E-11 |
| sp|Q08436|PMA3_NICPL | Plasma membrane ATPase 3 OS=Nicotiana plumbaginifolia GN=PMA3 PE=1 SV=1 | 56 | 370 | 7.0E-11 |
| sp|P28876|PMA2_SCHPO | Plasma membrane ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma2 PE=3 SV=1 | 71 | 383 | 9.0E-11 |
| sp|P22180|PMA1_SOLLC | Plasma membrane ATPase 1 OS=Solanum lycopersicum GN=LHA1 PE=2 SV=1 | 56 | 370 | 2.0E-10 |
| sp|P58165|AT2B2_OREMO | Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 | 159 | 283 | 4.0E-10 |
| sp|Q9SU58|PMA4_ARATH | ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=AHA4 PE=2 SV=2 | 56 | 370 | 4.0E-10 |
| sp|Q9SJB3|PMA5_ARATH | ATPase 5, plasma membrane-type OS=Arabidopsis thaliana GN=AHA5 PE=3 SV=3 | 52 | 366 | 5.0E-10 |
| sp|Q08435|PMA1_NICPL | Plasma membrane ATPase 1 OS=Nicotiana plumbaginifolia GN=PMA1 PE=2 SV=1 | 56 | 370 | 7.0E-10 |
| sp|Q9M2L4|ACA11_ARATH | Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 | 148 | 383 | 7.0E-10 |
| sp|Q9HDW7|ATC2_SCHPO | Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 | 162 | 383 | 1.0E-09 |
| sp|P24545|PMA1_ZYGRO | Plasma membrane ATPase OS=Zygosaccharomyces rouxii PE=3 SV=1 | 71 | 383 | 1.0E-09 |
| sp|Q2QMX9|ACA1_ORYSJ | Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1 | 63 | 371 | 1.0E-09 |
| sp|P83970|PMA1_WHEAT | Plasma membrane ATPase OS=Triticum aestivum GN=ha1 PE=2 SV=1 | 57 | 370 | 2.0E-09 |
| sp|Q9LV11|PMA11_ARATH | ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=AHA11 PE=1 SV=1 | 77 | 370 | 2.0E-09 |
| sp|O81108|ACA2_ARATH | Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1 | 56 | 371 | 2.0E-09 |
| sp|Q7XPY2|PMA1_ORYSJ | Plasma membrane ATPase OS=Oryza sativa subsp. japonica GN=Os04g0656100 PE=2 SV=1 | 57 | 370 | 3.0E-09 |
| sp|P9WPT3|CTPD_MYCTU | Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpD PE=3 SV=1 | 148 | 321 | 9.0E-09 |
| sp|P9WPT2|CTPD_MYCTO | Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpD PE=3 SV=1 | 148 | 321 | 9.0E-09 |
| sp|P63686|CTPD_MYCBO | Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpD PE=3 SV=1 | 148 | 321 | 9.0E-09 |
| sp|Q03194|PMA4_NICPL | Plasma membrane ATPase 4 OS=Nicotiana plumbaginifolia GN=PMA4 PE=2 SV=1 | 57 | 370 | 1.0E-08 |
| sp|P20649|PMA1_ARATH | ATPase 1, plasma membrane-type OS=Arabidopsis thaliana GN=AHA1 PE=1 SV=3 | 56 | 370 | 2.0E-08 |
| sp|P19456|PMA2_ARATH | ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=AHA2 PE=1 SV=2 | 56 | 370 | 2.0E-08 |
| sp|P49380|PMA1_KLULA | Plasma membrane ATPase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PMA1 PE=1 SV=1 | 69 | 282 | 2.0E-08 |
| sp|O64806|ACA7_ARATH | Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 | 56 | 371 | 4.0E-08 |
| sp|Q8RUN1|ACA3_ORYSJ | Calcium-transporting ATPase 3, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os01g0939100 PE=2 SV=1 | 56 | 383 | 5.0E-08 |
| sp|O31688|ZOSA_BACSU | Zinc-transporting ATPase OS=Bacillus subtilis (strain 168) GN=zosA PE=1 SV=1 | 145 | 362 | 1.0E-07 |
| sp|Q8CN02|COPA_STAES | Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1 | 145 | 336 | 2.0E-07 |
| sp|Q5HL56|COPA_STAEQ | Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1 | 145 | 336 | 2.0E-07 |
| sp|P54678|ATC1_DICDI | Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 | 145 | 364 | 2.0E-07 |
| sp|Q9SZR1|ACA10_ARATH | Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 | 141 | 383 | 2.0E-07 |
| sp|Q9T0E0|PMAX_ARATH | Putative ATPase, plasma membrane-like OS=Arabidopsis thaliana GN=At4g11730 PE=3 SV=1 | 58 | 366 | 2.0E-07 |
| sp|Q42556|PMA9_ARATH | ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=AHA9 PE=2 SV=2 | 57 | 370 | 2.0E-07 |
| sp|Q9LF79|ACA8_ARATH | Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 | 141 | 383 | 5.0E-07 |
| sp|Q6ATV4|ACA2_ORYSJ | Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1 | 185 | 371 | 8.0E-07 |
| sp|Q9LU41|ACA9_ARATH | Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 | 58 | 383 | 9.0E-07 |
| sp|Q4L970|COPA_STAHJ | Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 | 168 | 336 | 9.0E-07 |
| sp|O53114|CTPI_MYCLE | Probable cation-transporting ATPase I OS=Mycobacterium leprae (strain TN) GN=ctpI PE=3 SV=1 | 194 | 382 | 9.0E-07 |
| sp|Q07421|PMA1_AJECA | Plasma membrane ATPase OS=Ajellomyces capsulatus GN=PMA1 PE=3 SV=1 | 78 | 276 | 1.0E-06 |
| sp|P9WPS4|CTPI_MYCTO | Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 | 194 | 382 | 1.0E-06 |
| sp|P9WPS5|CTPI_MYCTU | Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 | 194 | 382 | 1.0E-06 |
| sp|P38929|ATC2_YEAST | Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 | 79 | 383 | 2.0E-06 |
| sp|Q4A0G1|COPA_STAS1 | Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1 | 165 | 347 | 3.0E-06 |
| sp|P37617|ATZN_ECOLI | Lead, cadmium, zinc and mercury-transporting ATPase OS=Escherichia coli (strain K12) GN=zntA PE=1 SV=1 | 139 | 307 | 3.0E-06 |
| sp|P32113|COPA_ENTHA | Probable copper-importing P-type ATPase A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copA PE=1 SV=2 | 147 | 330 | 6.0E-06 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 46 | 0.45 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 107 | 129 | 22 |
| 2 | 139 | 161 | 22 |
| 3 | 305 | 327 | 22 |
| 4 | 342 | 364 | 22 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|6087 LPPTSPYSGVPIEYRTLSSHVAESRNADADADADAAPGGADAKATVRRDDQDYFANLNLHELGADQLCQQLNVAP GSGLSESAAANRLRRDGANTLPRAKTNYGRKVFGYVFGGFCSVLWVGVIIFFLCWRPLSNPPSATNLALAILILI VIALQAGFSAFQDWSTQRTMRSITDLLPSEALAVREGRPRRLPASQLVSGDVVQLRAGDKVPADLRLLSHSGDIR FDRAVLTGESDEVEGAVDATDANFLESRNVALMGTLVVNGSGVGVVVLTGPRSVMGRIARATATAGERPTLIQRE IWRFVRIIVALTVVLALLILLTWALWLRRDHPGYMDVVAMLNNVMGCVVAFIPEGMPVAVALTLMTVARHMKAVS ILPKGLRAP* |
| Coding | >Hirsu2|6087 CTGCCGCCGACGTCGCCCTACTCGGGCGTGCCGATCGAGTACCGCACCCTGTCCAGCCACGTGGCCGAGTCGCGC AACGCCGACGCCGACGCCGACGCCGACGCGGCCCCGGGCGGCGCCGACGCCAAGGCCACCGTCCGCCGGGACGAC CAGGACTACTTCGCCAACCTCAACCTCCACGAGCTGGGCGCCGACCAGCTGTGCCAGCAGCTCAACGTGGCGCCC GGCTCCGGCCTGTCGGAGAGCGCGGCCGCGAACCGGCTGCGGCGCGACGGCGCCAACACGCTGCCGCGGGCCAAG ACCAACTACGGCCGCAAGGTCTTCGGCTACGTCTTCGGCGGCTTCTGCTCCGTCCTCTGGGTCGGCGTCATCATC TTCTTCCTCTGCTGGCGGCCGCTCAGCAACCCGCCCTCGGCCACGAACCTGGCGCTCGCCATCCTGATCCTCATC GTCATCGCGCTGCAGGCCGGCTTCTCGGCCTTCCAGGACTGGTCGACGCAGCGGACGATGCGGTCCATCACGGAC CTGCTGCCGTCCGAGGCGCTGGCCGTGCGCGAGGGCCGCCCGCGCCGGCTGCCGGCCTCGCAGCTCGTCAGCGGC GACGTCGTCCAGCTCCGCGCCGGCGACAAGGTGCCGGCCGACCTGCGCCTGCTGAGCCACTCGGGCGACATCCGC TTCGACCGCGCCGTGCTGACGGGCGAGTCGGACGAGGTCGAGGGCGCCGTCGACGCCACCGACGCCAACTTCCTC GAGAGCCGCAACGTGGCGCTCATGGGCACCCTGGTCGTCAACGGCTCCGGCGTCGGCGTCGTCGTCCTGACGGGC CCGCGCTCCGTCATGGGCCGCATCGCCCGCGCCACCGCCACGGCCGGCGAGCGCCCGACGCTGATCCAGCGCGAG ATCTGGCGCTTCGTCCGCATCATCGTCGCCCTGACCGTCGTCCTCGCCCTGCTGATCCTGCTGACCTGGGCCCTG TGGCTGCGCCGCGACCACCCGGGCTACATGGACGTCGTCGCCATGCTCAACAACGTCATGGGCTGCGTCGTCGCC TTCATCCCCGAGGGCATGCCCGTCGCCGTGGCCCTGACGCTGATGACCGTCGCCCGCCACATGAAGGCCGTCAGC ATCCTGCCCAAGGGGCTACGGGCACCCTGA |
| Transcript | >Hirsu2|6087 CTGCCGCCGACGTCGCCCTACTCGGGCGTGCCGATCGAGTACCGCACCCTGTCCAGCCACGTGGCCGAGTCGCGC AACGCCGACGCCGACGCCGACGCCGACGCGGCCCCGGGCGGCGCCGACGCCAAGGCCACCGTCCGCCGGGACGAC CAGGACTACTTCGCCAACCTCAACCTCCACGAGCTGGGCGCCGACCAGCTGTGCCAGCAGCTCAACGTGGCGCCC GGCTCCGGCCTGTCGGAGAGCGCGGCCGCGAACCGGCTGCGGCGCGACGGCGCCAACACGCTGCCGCGGGCCAAG ACCAACTACGGCCGCAAGGTCTTCGGCTACGTCTTCGGCGGCTTCTGCTCCGTCCTCTGGGTCGGCGTCATCATC TTCTTCCTCTGCTGGCGGCCGCTCAGCAACCCGCCCTCGGCCACGAACCTGGCGCTCGCCATCCTGATCCTCATC GTCATCGCGCTGCAGGCCGGCTTCTCGGCCTTCCAGGACTGGTCGACGCAGCGGACGATGCGGTCCATCACGGAC CTGCTGCCGTCCGAGGCGCTGGCCGTGCGCGAGGGCCGCCCGCGCCGGCTGCCGGCCTCGCAGCTCGTCAGCGGC GACGTCGTCCAGCTCCGCGCCGGCGACAAGGTGCCGGCCGACCTGCGCCTGCTGAGCCACTCGGGCGACATCCGC TTCGACCGCGCCGTGCTGACGGGCGAGTCGGACGAGGTCGAGGGCGCCGTCGACGCCACCGACGCCAACTTCCTC GAGAGCCGCAACGTGGCGCTCATGGGCACCCTGGTCGTCAACGGCTCCGGCGTCGGCGTCGTCGTCCTGACGGGC CCGCGCTCCGTCATGGGCCGCATCGCCCGCGCCACCGCCACGGCCGGCGAGCGCCCGACGCTGATCCAGCGCGAG ATCTGGCGCTTCGTCCGCATCATCGTCGCCCTGACCGTCGTCCTCGCCCTGCTGATCCTGCTGACCTGGGCCCTG TGGCTGCGCCGCGACCACCCGGGCTACATGGACGTCGTCGCCATGCTCAACAACGTCATGGGCTGCGTCGTCGCC TTCATCCCCGAGGGCATGCCCGTCGCCGTGGCCCTGACGCTGATGACCGTCGCCCGCCACATGAAGGCCGTCAGC ATCCTGCCCAAGGGGCTACGGGCACCCTGA |
| Gene | >Hirsu2|6087 CTGCCGCCGACGTCGCCCTACTCGGGCGTGCCGATCGAGTACCGCACCCTGTCCAGCCACGTGGCCGAGTCGCGC AACGCCGACGCCGACGCCGACGCCGACGCGGCCCCGGGCGGCGCCGACGCCAAGGCCACCGTCCGCCGGGACGAC CAGGACTACTTCGCCAACCTCAACCTCCACGAGCTGGGCGCCGACCAGCTGTGCCAGCAGCTCAACGTGGCGCCC GGCTCCGGCCTGTCGGAGAGCGCGGCCGCGAACCGGCTGCGGCGCGACGGCGCCAACACGCTGCCGCGGGCCAAG ACCAACTACGGCCGCAAGGTCTTCGGCTACGTCTTCGGCGGCTTCTGCTCCGTCCTCTGGGTCGGCGTCATCATC TTCTTCCTCTGCTGGCGGCCGCTCAGCAACCCGCCCTCGGCCACGAACCTGGCGCTCGCCATCCTGATCCTCATC GTCATCGCGCTGCAGGCCGGCTTCTCGGCCTTCCAGGACTGGTCGACGCAGCGGACGATGCGGTCCATCACGGAC CTGCTGCCGTCCGAGGCGCTGGCCGTGCGCGAGGGCCGCCCGCGCCGGCTGCCGGCCTCGCAGCTCGTCAGCGGC GACGTCGTCCAGCTCCGCGCCGGCGACAAGGTGCCGGCCGACCTGCGCCTGCTGAGCCACTCGGGCGACATCCGC TTCGACCGCGCCGTGCTGACGGGCGAGTCGGACGAGGTCGAGGGCGCCGTCGACGCCACCGACGCCAACTTCCTC GAGAGCCGCAACGTGGCGCTCATGGGCACCCTGGTCGTCAACGGCTCCGGCGTCGGCGTCGTCGTCCTGACGGGC CCGCGCTCCGTCATGGGCCGCATCGCCCGCGCCACCGCCACGGCCGGCGAGCGCCCGACGCTGATCCAGCGCGAG ATCTGGCGCTTCGTCCGCATCATCGTCGCCCTGACCGTCGTCCTCGCCCTGCTGATCCTGCTGACCTGGGCCCTG TGGCTGCGCCGCGACCACCCGGGCTACATGGACGTCGTCGCCATGCTCAACAACGTCATGGGCTGCGTCGTCGCC TTCATCCCCGAGGGCATGCCCGTCGCCGTGGCCCTGACGCTGATGACCGTCGCCCGCCACATGAAGGCCGTCAGC ATCCTGCCCAAGGGGCTGTCGACGGTCGAGACGCTCGGCTGCGTCGACGTCATCTGCTCCGACAAGACGGGCACC CTGA |