Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6085
Gene name
LocationContig_308:16192..17961
Strand+
Gene length (bp)1769
Transcript length (bp)1560
Coding sequence length (bp)1560
Protein length (aa) 520

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02096 60KD_IMP 60Kd inner membrane protein 2.4E-10 209 400

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13375|OXA1_KAZSE Mitochondrial inner membrane protein OXA1 OS=Kazachstania servazzii GN=OXA1 PE=3 SV=1 149 429 2.0E-23
sp|P39952|OXA1_YEAST Mitochondrial inner membrane protein OXA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OXA1 PE=1 SV=1 137 472 3.0E-23
sp|Q8BGA9|OXA1L_MOUSE Mitochondrial inner membrane protein OXA1L OS=Mus musculus GN=Oxa1l PE=1 SV=1 193 414 3.0E-15
sp|O43092|OXA12_SCHPO Mitochondrial inner membrane protein oxa1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oxa102 PE=2 SV=2 186 344 7.0E-15
sp|Q15070|OXA1L_HUMAN Mitochondrial inner membrane protein OXA1L OS=Homo sapiens GN=OXA1L PE=1 SV=3 193 420 5.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13375|OXA1_KAZSE Mitochondrial inner membrane protein OXA1 OS=Kazachstania servazzii GN=OXA1 PE=3 SV=1 149 429 2.0E-23
sp|P39952|OXA1_YEAST Mitochondrial inner membrane protein OXA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OXA1 PE=1 SV=1 137 472 3.0E-23
sp|Q8BGA9|OXA1L_MOUSE Mitochondrial inner membrane protein OXA1L OS=Mus musculus GN=Oxa1l PE=1 SV=1 193 414 3.0E-15
sp|O43092|OXA12_SCHPO Mitochondrial inner membrane protein oxa1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oxa102 PE=2 SV=2 186 344 7.0E-15
sp|Q15070|OXA1L_HUMAN Mitochondrial inner membrane protein OXA1L OS=Homo sapiens GN=OXA1L PE=1 SV=3 193 420 5.0E-14
sp|O14300|OXA11_SCHPO Mitochondrial inner membrane protein oxa1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oxa101 PE=2 SV=1 183 507 1.0E-11
sp|Q42191|OXA1_ARATH Mitochondrial inner membrane protein OXA1 OS=Arabidopsis thaliana GN=OXA1 PE=2 SV=2 194 414 2.0E-11
sp|Q3SYV3|OXA1L_BOVIN Mitochondrial inner membrane protein OXA1L OS=Bos taurus GN=OXA1L PE=2 SV=1 193 414 3.0E-11
sp|Q9HT06|YIDC_PSEAE Membrane protein insertase YidC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=yidC PE=3 SV=1 182 375 6.0E-10
sp|Q02DE0|YIDC_PSEAB Membrane protein insertase YidC OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=yidC PE=3 SV=1 182 375 7.0E-10
sp|B7V7A5|YIDC_PSEA8 Membrane protein insertase YidC OS=Pseudomonas aeruginosa (strain LESB58) GN=yidC PE=3 SV=1 182 375 7.0E-10
sp|A6VF45|YIDC_PSEA7 Membrane protein insertase YidC OS=Pseudomonas aeruginosa (strain PA7) GN=yidC PE=3 SV=1 184 375 9.0E-10
sp|Q4UNK8|YIDC_XANC8 Membrane protein insertase YidC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=yidC PE=3 SV=1 196 399 1.0E-09
sp|Q8P338|YIDC_XANCP Membrane protein insertase YidC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=yidC PE=3 SV=1 196 399 1.0E-09
sp|Q8PEH7|YIDC_XANAC Membrane protein insertase YidC OS=Xanthomonas axonopodis pv. citri (strain 306) GN=yidC PE=3 SV=1 196 397 1.0E-09
sp|Q3BLZ7|YIDC_XANC5 Membrane protein insertase YidC OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=yidC PE=3 SV=1 196 399 2.0E-09
sp|Q5P4P4|YIDC_AROAE Membrane protein insertase YidC OS=Aromatoleum aromaticum (strain EbN1) GN=yidC PE=3 SV=1 125 385 2.0E-09
sp|Q477Q4|YIDC_DECAR Membrane protein insertase YidC OS=Dechloromonas aromatica (strain RCB) GN=yidC PE=3 SV=1 184 379 4.0E-09
sp|A4T0N2|YIDC_POLSQ Membrane protein insertase YidC OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=yidC PE=3 SV=1 185 368 3.0E-08
sp|Q4K395|YIDC_PSEF5 Membrane protein insertase YidC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=yidC PE=3 SV=1 182 375 8.0E-08
sp|Q5F4W6|YIDC_NEIG1 Membrane protein insertase YidC OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=yidC PE=3 SV=1 124 374 9.0E-08
sp|B4RJJ2|YIDC_NEIG2 Membrane protein insertase YidC OS=Neisseria gonorrhoeae (strain NCCP11945) GN=yidC PE=3 SV=1 124 374 1.0E-07
sp|C1DNF7|YIDC_AZOVD Membrane protein insertase YidC OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=yidC PE=3 SV=1 182 401 1.0E-07
sp|Q1I2H4|YIDC_PSEE4 Membrane protein insertase YidC OS=Pseudomonas entomophila (strain L48) GN=yidC PE=3 SV=1 182 375 2.0E-07
sp|A4VS82|YIDC_PSEU5 Membrane protein insertase YidC OS=Pseudomonas stutzeri (strain A1501) GN=yidC PE=3 SV=1 182 372 2.0E-07
sp|Q21DG0|YIDC_SACD2 Membrane protein insertase YidC OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=yidC PE=3 SV=1 182 380 3.0E-07
sp|A4Y1A0|YIDC_PSEMY Membrane protein insertase YidC OS=Pseudomonas mendocina (strain ymp) GN=yidC PE=3 SV=1 171 401 4.0E-07
sp|Q7MQK5|YIDC_VIBVY Membrane protein insertase YidC OS=Vibrio vulnificus (strain YJ016) GN=yidC PE=3 SV=1 184 375 4.0E-07
sp|Q8DDI2|YIDC_VIBVU Membrane protein insertase YidC OS=Vibrio vulnificus (strain CMCP6) GN=yidC PE=3 SV=1 184 375 4.0E-07
sp|B1JFV4|YIDC_PSEPW Membrane protein insertase YidC OS=Pseudomonas putida (strain W619) GN=yidC PE=3 SV=1 184 375 5.0E-07
sp|A5WBB7|YIDC_PSEP1 Membrane protein insertase YidC OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=yidC PE=3 SV=1 184 375 5.0E-07
sp|P0A141|YIDC_PSEPU Membrane protein insertase YidC OS=Pseudomonas putida GN=yidC PE=3 SV=1 184 375 5.0E-07
sp|P0A140|YIDC_PSEPK Membrane protein insertase YidC OS=Pseudomonas putida (strain KT2440) GN=yidC PE=3 SV=1 184 375 5.0E-07
sp|B0KRC1|YIDC_PSEPG Membrane protein insertase YidC OS=Pseudomonas putida (strain GB-1) GN=yidC PE=3 SV=1 184 375 5.0E-07
sp|A6TG08|YIDC_KLEP7 Membrane protein insertase YidC OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=yidC PE=3 SV=1 182 375 6.0E-07
sp|B5XZP5|YIDC_KLEP3 Membrane protein insertase YidC OS=Klebsiella pneumoniae (strain 342) GN=yidC PE=3 SV=1 182 375 6.0E-07
sp|Q4ZL11|YIDC_PSEU2 Membrane protein insertase YidC OS=Pseudomonas syringae pv. syringae (strain B728a) GN=yidC PE=3 SV=1 182 375 7.0E-07
sp|C5BKL7|YIDC_TERTT Membrane protein insertase YidC OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=yidC PE=3 SV=1 182 369 7.0E-07
sp|Q48BF2|YIDC_PSE14 Membrane protein insertase YidC OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=yidC PE=3 SV=1 182 375 8.0E-07
sp|Q87TS1|YIDC_PSESM Membrane protein insertase YidC OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=yidC PE=3 SV=1 182 375 8.0E-07
sp|Q3K428|YIDC_PSEPF Membrane protein insertase YidC OS=Pseudomonas fluorescens (strain Pf0-1) GN=yidC PE=3 SV=1 182 375 8.0E-07
sp|C3LP77|YIDC_VIBCM Membrane protein insertase YidC OS=Vibrio cholerae serotype O1 (strain M66-2) GN=yidC PE=3 SV=1 184 375 9.0E-07
sp|Q9KVY4|YIDC_VIBCH Membrane protein insertase YidC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=yidC PE=3 SV=1 184 375 9.0E-07
sp|A5F484|YIDC_VIBC3 Membrane protein insertase YidC OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=yidC PE=3 SV=1 184 375 9.0E-07
sp|B3R883|YIDC_CUPTR Membrane protein insertase YidC OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=yidC PE=3 SV=1 185 396 1.0E-06
sp|C3K1G2|YIDC_PSEFS Membrane protein insertase YidC OS=Pseudomonas fluorescens (strain SBW25) GN=yidC PE=3 SV=1 182 375 1.0E-06
sp|Q7VPM2|YIDC_HAEDU Membrane protein insertase YidC OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=yidC PE=3 SV=1 182 375 2.0E-06
sp|A1KRZ8|YIDC_NEIMF Membrane protein insertase YidC OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=yidC PE=3 SV=1 124 374 2.0E-06
sp|Q9JXS4|YIDC_NEIMB Membrane protein insertase YidC OS=Neisseria meningitidis serogroup B (strain MC58) GN=yidC PE=3 SV=1 124 374 2.0E-06
sp|A9M152|YIDC_NEIM0 Membrane protein insertase YidC OS=Neisseria meningitidis serogroup C (strain 053442) GN=yidC PE=3 SV=1 124 374 3.0E-06
sp|Q9JW48|YIDC_NEIMA Membrane protein insertase YidC OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=yidC PE=3 SV=1 124 374 3.0E-06
sp|Q0K5C1|YIDC_CUPNH Membrane protein insertase YidC OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=yidC PE=3 SV=1 185 396 3.0E-06
sp|Q2Y5A8|YIDC_NITMU Membrane protein insertase YidC OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=yidC PE=3 SV=1 141 369 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0032977 membrane insertase activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008565 protein transporter activity No
GO:0003674 molecular_function No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 201 223 22
2 282 304 22
3 332 354 22
4 367 389 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6085
MLPSRGIVRSIPSAGAGRPLHSRLAKAPNALSHRFAAERRQLGTLRRSLGAGGATTRAVPRSSPLSSRNAAAPVM
MLGGGGISSSSRAFSVWGWGWGGGSKKGTETDGTAATTTTTTTTTTTTTDEAVAAAQSAPAPAVESAAAATEPSV
AASEVDLSSLDSIVNGRDILNMPEQLGYLHAIGLDYGWGATSVMQWALEHVHVWGGLGWGGSIAATAVLLRLAMA
YPQVRAVRYSGKMAKMRADPRSAEAMQLFSRGLAEGDNELRQRSQFINKMLRRQYGVSHWGLLWSFAQLPFTFGL
FRIVTGMTSVPVPALETAGYLWFPDLTASDPYFILPAVATGLMVSSVVINSQFTPTAQQQMAKTIMYIIGTVGFV
ATTFLSSAVNLMAVSVGAMTLLTSAVLSNLRVRAALGLPLERFPPPSSPSKSASVASVAAAAAADGKPVYQPPRP
APGLRQRITDNLDGMKKGLSDQLSTYTGRYAESEKDKAGKRRRELLQKLEAARKQQEQEDFERKYKAKP*
Coding >Hirsu2|6085
ATGCTTCCAAGCAGGGGAATCGTGCGTTCCATCCCCTCTGCTGGGGCCGGCAGGCCACTCCACAGCCGATTGGCG
AAAGCACCGAATGCCTTGTCGCACCGGTTCGCGGCCGAACGGCGCCAGCTGGGGACTCTGCGGCGGAGTCTGGGC
GCCGGGGGGGCAACGACAAGAGCCGTGCCGCGCAGCAGCCCGTTATCAAGTCGGAATGCGGCCGCGCCCGTCATG
ATGCTCGGCGGCGGCGGCATCTCGTCATCCTCGCGGGCCTTTTCCGTCTGGGGCTGGGGCTGGGGCGGCGGCTCC
AAGAAGGGCACGGAGACGGACGGGACCGCGGCGACGACGACAACAACAACGACGACGACGACGACGACGACGGAC
GAAGCCGTAGCAGCCGCGCAGTCGGCGCCCGCGCCAGCCGTGGAAAGCGCCGCGGCGGCGACGGAGCCGTCGGTG
GCGGCGTCCGAGGTGGACCTGTCGTCGCTGGACAGCATCGTCAACGGGCGCGACATCCTCAACATGCCGGAGCAG
CTGGGCTACCTGCACGCCATCGGGCTCGACTACGGCTGGGGCGCGACGTCGGTGATGCAGTGGGCGCTGGAGCAC
GTGCACGTCTGGGGCGGGCTGGGCTGGGGCGGCTCGATCGCGGCGACGGCGGTGCTGCTGCGGCTGGCCATGGCG
TACCCGCAGGTGCGCGCCGTCCGCTACTCGGGCAAGATGGCCAAGATGCGGGCGGACCCGCGCTCGGCCGAGGCG
ATGCAGCTCTTCAGCCGCGGCCTGGCCGAGGGCGACAACGAGCTGCGCCAGCGGTCGCAGTTCATCAACAAGATG
CTGCGCCGCCAGTACGGCGTCAGCCACTGGGGCCTGCTGTGGTCCTTCGCCCAGCTGCCCTTCACCTTCGGCCTC
TTCCGCATCGTCACCGGCATGACGTCCGTCCCGGTCCCGGCCCTCGAGACGGCCGGCTACCTGTGGTTCCCCGAC
CTGACCGCCTCGGACCCCTACTTCATCCTGCCCGCCGTCGCCACCGGCCTCATGGTCTCCTCCGTCGTCATCAAC
TCCCAGTTCACGCCGACGGCGCAGCAGCAGATGGCCAAGACCATCATGTACATCATCGGCACCGTCGGCTTCGTC
GCCACCACCTTCCTCTCCTCCGCCGTCAACCTCATGGCCGTCTCCGTCGGCGCCATGACGCTCCTCACCTCCGCC
GTCCTCAGCAACCTCCGCGTCCGCGCCGCCCTCGGCCTCCCCCTCGAGCGCTTCCCCCCGCCCTCCTCCCCCTCC
AAGTCCGCCTCCGTCGCCTCCGTCGCCGCCGCCGCCGCCGCCGACGGCAAGCCCGTCTACCAGCCGCCCCGCCCC
GCCCCGGGCCTCCGCCAGCGCATCACCGACAACCTCGACGGCATGAAGAAGGGCCTCTCGGACCAGCTCAGCACC
TACACCGGCCGCTACGCCGAGTCGGAGAAGGACAAGGCCGGCAAGCGCCGCCGCGAGCTGCTGCAGAAGCTCGAG
GCCGCGCGCAAGCAGCAGGAGCAGGAGGATTTTGAGAGGAAGTACAAGGCCAAGCCGTAA
Transcript >Hirsu2|6085
ATGCTTCCAAGCAGGGGAATCGTGCGTTCCATCCCCTCTGCTGGGGCCGGCAGGCCACTCCACAGCCGATTGGCG
AAAGCACCGAATGCCTTGTCGCACCGGTTCGCGGCCGAACGGCGCCAGCTGGGGACTCTGCGGCGGAGTCTGGGC
GCCGGGGGGGCAACGACAAGAGCCGTGCCGCGCAGCAGCCCGTTATCAAGTCGGAATGCGGCCGCGCCCGTCATG
ATGCTCGGCGGCGGCGGCATCTCGTCATCCTCGCGGGCCTTTTCCGTCTGGGGCTGGGGCTGGGGCGGCGGCTCC
AAGAAGGGCACGGAGACGGACGGGACCGCGGCGACGACGACAACAACAACGACGACGACGACGACGACGACGGAC
GAAGCCGTAGCAGCCGCGCAGTCGGCGCCCGCGCCAGCCGTGGAAAGCGCCGCGGCGGCGACGGAGCCGTCGGTG
GCGGCGTCCGAGGTGGACCTGTCGTCGCTGGACAGCATCGTCAACGGGCGCGACATCCTCAACATGCCGGAGCAG
CTGGGCTACCTGCACGCCATCGGGCTCGACTACGGCTGGGGCGCGACGTCGGTGATGCAGTGGGCGCTGGAGCAC
GTGCACGTCTGGGGCGGGCTGGGCTGGGGCGGCTCGATCGCGGCGACGGCGGTGCTGCTGCGGCTGGCCATGGCG
TACCCGCAGGTGCGCGCCGTCCGCTACTCGGGCAAGATGGCCAAGATGCGGGCGGACCCGCGCTCGGCCGAGGCG
ATGCAGCTCTTCAGCCGCGGCCTGGCCGAGGGCGACAACGAGCTGCGCCAGCGGTCGCAGTTCATCAACAAGATG
CTGCGCCGCCAGTACGGCGTCAGCCACTGGGGCCTGCTGTGGTCCTTCGCCCAGCTGCCCTTCACCTTCGGCCTC
TTCCGCATCGTCACCGGCATGACGTCCGTCCCGGTCCCGGCCCTCGAGACGGCCGGCTACCTGTGGTTCCCCGAC
CTGACCGCCTCGGACCCCTACTTCATCCTGCCCGCCGTCGCCACCGGCCTCATGGTCTCCTCCGTCGTCATCAAC
TCCCAGTTCACGCCGACGGCGCAGCAGCAGATGGCCAAGACCATCATGTACATCATCGGCACCGTCGGCTTCGTC
GCCACCACCTTCCTCTCCTCCGCCGTCAACCTCATGGCCGTCTCCGTCGGCGCCATGACGCTCCTCACCTCCGCC
GTCCTCAGCAACCTCCGCGTCCGCGCCGCCCTCGGCCTCCCCCTCGAGCGCTTCCCCCCGCCCTCCTCCCCCTCC
AAGTCCGCCTCCGTCGCCTCCGTCGCCGCCGCCGCCGCCGCCGACGGCAAGCCCGTCTACCAGCCGCCCCGCCCC
GCCCCGGGCCTCCGCCAGCGCATCACCGACAACCTCGACGGCATGAAGAAGGGCCTCTCGGACCAGCTCAGCACC
TACACCGGCCGCTACGCCGAGTCGGAGAAGGACAAGGCCGGCAAGCGCCGCCGCGAGCTGCTGCAGAAGCTCGAG
GCCGCGCGCAAGCAGCAGGAGCAGGAGGATTTTGAGAGGAAGTACAAGGCCAAGCCGTAA
Gene >Hirsu2|6085
ATGCTTCCAAGCAGGGGAATCGTGCGTTCCATCCCCTCTGCTGGGGCCGGCAGGCCACTCCACAGCCGATTGGCG
GTGCGCTTCTCCTTCTCTCCCCCTCCTTCTCCCGCACAACATGACGAGCTCGAGTCCGAGCTTCCTCCCGCCCTG
CCTCTCATTGTTTTTTTTTCTCCCTCACCTCCCATCTCAGATTGCTTCGACCCGGATTCGCTGACGGGCTAGTCG
CAGAAAGCACCGAATGCCTTGTCGCACCGGTTCGCGGCCGAACGGCGCCAGCTGGGGACTCTGCGGCGGAGTCTG
GGCGCCGGGGGGGCAACGACAAGAGCCGTGCCGCGCAGCAGCCCGTTATCAAGTCGGAATGCGGCCGCGCCCGTC
ATGATGCTCGGCGGCGGCGGCATCTCGTCATCCTCGCGGGCCTTTTCCGTCTGGGGCTGGGGCTGGGGCGGCGGC
TCCAAGAAGGGCACGGAGACGGACGGGACCGCGGCGACGACGACAACAACAACGACGACGACGACGACGACGACG
GACGAAGCCGTAGCAGCCGCGCAGTCGGCGCCCGCGCCAGCCGTGGAAAGCGCCGCGGCGGCGACGGAGCCGTCG
GTGGCGGCGTCCGAGGTGGACCTGTCGTCGCTGGACAGCATCGTCAACGGGCGCGACATCCTCAACATGCCGGAG
CAGCTGGGCTACCTGCACGCCATCGGGCTCGACTACGGCTGGGGCGCGACGTCGGTGATGCAGTGGGCGCTGGAG
CACGTGCACGTCTGGGGCGGGCTGGGCTGGGGCGGCTCGATCGCGGCGACGGCGGTGCTGCTGCGGCTGGCCATG
GCGTACCCGCAGGTGCGCGCCGTCCGCTACTCGGGCAAGATGGCCAAGATGCGGGCGGACCCGCGCTCGGCCGAG
GCGATGCAGCTCTTCAGCCGCGGCCTGGCCGAGGGCGACAACGAGCTGCGCCAGCGGTCGCAGTTCATCAACAAG
ATGCTGCGCCGCCAGTACGGCGTCAGCCACTGGGGCCTGCTGTGGTCCTTCGCCCAGCTGCCCTTCACCTTCGGC
CTCTTCCGCATCGTCACCGGCATGACGTCCGTCCCGGTCCCGGCCCTCGAGACGGCCGGCTACCTGTGGTTCCCC
GACCTGACCGCCTCGGACCCCTACTTCATCCTGCCCGCCGTCGCCACCGGCCTCATGGTCTCCTCCGTCGTCGTA
CGTCCTCGCCCCTCCCCTCTTCTCGCCTGCCCGCTGACCGACCCGCCCGCAAGATCAACTCCCAGTTCACGCCGA
CGGCGCAGCAGCAGATGGCCAAGACCATCATGTACATCATCGGCACCGTCGGCTTCGTCGCCACCACCTTCCTCT
CCTCCGCCGTCAACCTCATGGCCGTCTCCGTCGGCGCCATGACGCTCCTCACCTCCGCCGTCCTCAGCAACCTCC
GCGTCCGCGCCGCCCTCGGCCTCCCCCTCGAGCGCTTCCCCCCGCCCTCCTCCCCCTCCAAGTCCGCCTCCGTCG
CCTCCGTCGCCGCCGCCGCCGCCGCCGACGGCAAGCCCGTCTACCAGCCGCCCCGCCCCGCCCCGGGCCTCCGCC
AGCGCATCACCGACAACCTCGACGGCATGAAGAAGGGCCTCTCGGACCAGCTCAGCACCTACACCGGCCGCTACG
CCGAGTCGGAGAAGGACAAGGCCGGCAAGCGCCGCCGCGAGCTGCTGCAGAAGCTCGAGGCCGCGCGCAAGCAGC
AGGAGCAGGAGGATTTTGAGAGGAAGTACAAGGCCAAGCCGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail