Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|608
Gene name
LocationContig_112:32227..33214
Strand+
Gene length (bp)987
Transcript length (bp)987
Coding sequence length (bp)987
Protein length (aa) 329

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14748 P5CR_dimer Pyrroline-5-carboxylate reductase dimerisation 3.4E-31 207 308
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 1.1E-10 48 121

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12740|P5CR_ZALAR Pyrroline-5-carboxylate reductase OS=Zalerion arboricola GN=P5CR PE=2 SV=1 1 321 1.0E-132
sp|Q12641|P5CR_NEUCR Pyrroline-5-carboxylate reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pro-1 PE=3 SV=2 46 321 2.0E-84
sp|Q9P7Y7|P5CR_SCHPO Pyrroline-5-carboxylate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pro3 PE=3 SV=1 1 311 3.0E-58
sp|P32263|P5CR_YEAST Pyrroline-5-carboxylate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRO3 PE=1 SV=1 44 311 3.0E-37
sp|P74572|P5CR_SYNY3 Pyrroline-5-carboxylate reductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=proC PE=3 SV=1 77 311 1.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12740|P5CR_ZALAR Pyrroline-5-carboxylate reductase OS=Zalerion arboricola GN=P5CR PE=2 SV=1 1 321 1.0E-132
sp|Q12641|P5CR_NEUCR Pyrroline-5-carboxylate reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pro-1 PE=3 SV=2 46 321 2.0E-84
sp|Q9P7Y7|P5CR_SCHPO Pyrroline-5-carboxylate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pro3 PE=3 SV=1 1 311 3.0E-58
sp|P32263|P5CR_YEAST Pyrroline-5-carboxylate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRO3 PE=1 SV=1 44 311 3.0E-37
sp|P74572|P5CR_SYNY3 Pyrroline-5-carboxylate reductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=proC PE=3 SV=1 77 311 1.0E-35
sp|Q6CR99|P5CR_KLULA Pyrroline-5-carboxylate reductase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRO3 PE=1 SV=1 36 311 2.0E-34
sp|Q5R9X6|P5CR1_PONAB Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Pongo abelii GN=PYCR1 PE=2 SV=1 78 305 2.0E-26
sp|P32322|P5CR1_HUMAN Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens GN=PYCR1 PE=1 SV=2 78 305 2.0E-26
sp|Q17QJ7|P5CR2_BOVIN Pyrroline-5-carboxylate reductase 2 OS=Bos taurus GN=PYCR2 PE=2 SV=1 76 305 2.0E-25
sp|Q6AY23|P5CR2_RAT Pyrroline-5-carboxylate reductase 2 OS=Rattus norvegicus GN=Pycr2 PE=2 SV=1 76 305 3.0E-25
sp|Q922Q4|P5CR2_MOUSE Pyrroline-5-carboxylate reductase 2 OS=Mus musculus GN=Pycr2 PE=1 SV=1 76 305 4.0E-25
sp|Q922W5|P5CR1_MOUSE Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Mus musculus GN=Pycr1 PE=1 SV=1 78 305 4.0E-25
sp|Q4R6W7|P5CR2_MACFA Pyrroline-5-carboxylate reductase 2 OS=Macaca fascicularis GN=PYCR2 PE=2 SV=1 76 305 5.0E-25
sp|Q5RAQ3|P5CR2_PONAB Pyrroline-5-carboxylate reductase 2 OS=Pongo abelii GN=PYCR2 PE=2 SV=1 76 305 1.0E-24
sp|Q9HH99|P5CR_METAC Pyrroline-5-carboxylate reductase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=proC PE=3 SV=1 74 311 2.0E-24
sp|P0C1E4|P5CR_CORGL Pyrroline-5-carboxylate reductase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=proC PE=3 SV=1 77 311 7.0E-24
sp|P0C1E5|P5CR_CORML Pyrroline-5-carboxylate reductase OS=Corynebacterium melassecola GN=proC PE=3 SV=1 77 311 7.0E-24
sp|P54904|P5CR1_ARATH Pyrroline-5-carboxylate reductase OS=Arabidopsis thaliana GN=PROC1 PE=2 SV=1 83 299 1.0E-23
sp|Q96C36|P5CR2_HUMAN Pyrroline-5-carboxylate reductase 2 OS=Homo sapiens GN=PYCR2 PE=1 SV=1 76 305 2.0E-23
sp|P0A9L9|P5CR_SHIFL Pyrroline-5-carboxylate reductase OS=Shigella flexneri GN=proC PE=3 SV=1 1 311 2.0E-23
sp|P0A9L8|P5CR_ECOLI Pyrroline-5-carboxylate reductase OS=Escherichia coli (strain K12) GN=proC PE=1 SV=1 1 311 2.0E-23
sp|P17817|P5CR_SOYBN Pyrroline-5-carboxylate reductase OS=Glycine max PE=2 SV=1 51 299 3.0E-23
sp|O04016|P5CR_ACTCH Pyrroline-5-carboxylate reductase OS=Actinidia chinensis PE=2 SV=1 71 311 1.0E-22
sp|Q58DT4|P5CR1_BOVIN Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Bos taurus GN=PYCR1 PE=2 SV=1 76 304 1.0E-22
sp|Q04708|P5CR_PEA Pyrroline-5-carboxylate reductase OS=Pisum sativum GN=PROC PE=2 SV=1 63 299 9.0E-22
sp|Q58D08|P5CR3_BOVIN Pyrroline-5-carboxylate reductase 3 OS=Bos taurus GN=PYCRL PE=2 SV=1 76 311 1.0E-21
sp|Q53H96|P5CR3_HUMAN Pyrroline-5-carboxylate reductase 3 OS=Homo sapiens GN=PYCRL PE=1 SV=3 87 311 3.0E-20
sp|A1L2Q8|P5CR3_XENLA Pyrroline-5-carboxylate reductase 3 OS=Xenopus laevis GN=pycrl PE=2 SV=2 76 311 5.0E-20
sp|Q9DCC4|P5CR3_MOUSE Pyrroline-5-carboxylate reductase 3 OS=Mus musculus GN=Pycrl PE=1 SV=2 76 311 5.0E-18
sp|P43869|P5CR_HAEIN Pyrroline-5-carboxylate reductase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=proC PE=3 SV=1 39 300 6.0E-18
sp|Q5PQJ6|P5CR3_RAT Pyrroline-5-carboxylate reductase 3 OS=Rattus norvegicus GN=Pycrl PE=2 SV=1 76 311 1.0E-17
sp|Q4R531|P5CR3_MACFA Pyrroline-5-carboxylate reductase 3 OS=Macaca fascicularis GN=PYCRL PE=2 SV=1 87 311 2.0E-17
sp|P54552|P5CR2_BACSU Pyrroline-5-carboxylate reductase 2 OS=Bacillus subtilis (strain 168) GN=proI PE=3 SV=1 76 322 2.0E-17
sp|P46725|P5CR_MYCLE Pyrroline-5-carboxylate reductase OS=Mycobacterium leprae (strain TN) GN=proC PE=3 SV=1 81 309 4.0E-17
sp|P54893|P5CR_THET2 Pyrroline-5-carboxylate reductase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=proC PE=3 SV=1 153 311 4.0E-17
sp|P0CI77|P5CR1_BACSU Pyrroline-5-carboxylate reductase 1 OS=Bacillus subtilis (strain 168) GN=proH PE=3 SV=1 86 314 7.0E-17
sp|P9WHU7|P5CR_MYCTU Pyrroline-5-carboxylate reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=proC PE=1 SV=1 113 309 1.0E-15
sp|P9WHU6|P5CR_MYCTO Pyrroline-5-carboxylate reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=proC PE=3 SV=1 113 309 1.0E-15
sp|Q5SPD7|P5CR3_DANRE Pyrroline-5-carboxylate reductase 3 OS=Danio rerio GN=pycrl PE=2 SV=1 44 292 2.0E-15
sp|P27771|P5CR_TREPA Pyrroline-5-carboxylate reductase OS=Treponema pallidum (strain Nichols) GN=proC PE=1 SV=2 83 302 8.0E-15
sp|P52053|P5CR_VIBAL Pyrroline-5-carboxylate reductase OS=Vibrio alginolyticus GN=proC PE=3 SV=1 77 311 2.0E-14
sp|E0TY11|P5CR1_BACPZ Pyrroline-5-carboxylate reductase 1 OS=Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) GN=proH PE=3 SV=2 86 302 3.0E-14
sp|O66553|P5CR_AQUAE Pyrroline-5-carboxylate reductase OS=Aquifex aeolicus (strain VF5) GN=proC PE=3 SV=1 82 309 9.0E-13
sp|P22008|P5CR_PSEAE Pyrroline-5-carboxylate reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=proC PE=1 SV=2 74 311 4.0E-12
sp|Q20848|P5CR_CAEEL Putative pyrroline-5-carboxylate reductase OS=Caenorhabditis elegans GN=F55G1.9 PE=3 SV=1 198 311 6.0E-12
sp|Q9CPE8|P5CR_PASMU Pyrroline-5-carboxylate reductase OS=Pasteurella multocida (strain Pm70) GN=proC PE=3 SV=1 39 279 3.0E-10
sp|Q49XV0|P5CR_STAS1 Pyrroline-5-carboxylate reductase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=proC PE=3 SV=1 61 302 4.0E-10
sp|Q7A0U1|P5CR_STAAW Pyrroline-5-carboxylate reductase OS=Staphylococcus aureus (strain MW2) GN=proC PE=3 SV=1 77 288 1.0E-09
sp|Q6G961|P5CR_STAAS Pyrroline-5-carboxylate reductase OS=Staphylococcus aureus (strain MSSA476) GN=proC PE=3 SV=1 77 288 1.0E-09
sp|Q7A5G8|P5CR_STAAN Pyrroline-5-carboxylate reductase OS=Staphylococcus aureus (strain N315) GN=proC PE=1 SV=1 77 288 1.0E-09
sp|Q99TZ0|P5CR_STAAM Pyrroline-5-carboxylate reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=proC PE=3 SV=1 77 288 1.0E-09
sp|Q6GGJ5|P5CR_STAAR Pyrroline-5-carboxylate reductase OS=Staphylococcus aureus (strain MRSA252) GN=proC PE=3 SV=1 77 288 1.0E-09
sp|Q5HFR9|P5CR_STAAC Pyrroline-5-carboxylate reductase OS=Staphylococcus aureus (strain COL) GN=proC PE=3 SV=1 77 288 1.0E-09
sp|Q8CP51|P5CR_STAES Pyrroline-5-carboxylate reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=proC PE=3 SV=1 77 283 2.0E-09
sp|Q5HP48|P5CR_STAEQ Pyrroline-5-carboxylate reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=proC PE=3 SV=1 77 283 2.0E-09
sp|Q55E34|P5CR2_DICDI Pyrroline-5-carboxylate reductase 2 OS=Dictyostelium discoideum GN=pycr2 PE=3 SV=1 74 299 2.0E-08
sp|Q54IL7|P5CR1_DICDI Pyrroline-5-carboxylate reductase 1 OS=Dictyostelium discoideum GN=pycr1 PE=3 SV=1 158 288 2.0E-08
sp|Q9ZK56|P5CR_HELPJ Pyrroline-5-carboxylate reductase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=proC PE=3 SV=1 197 303 2.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5082 0.4028 0.0689 0.058 0.6222 0.0563 0.2668 0.2816 0.3398 0.1549

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup580
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2902
Ophiocordyceps australis 1348a (Ghana) OphauG2|2904
Ophiocordyceps australis map64 (Brazil) OphauB2|2035
Ophiocordyceps australis map64 (Brazil) OphauB2|772
Ophiocordyceps camponoti-floridani Ophcf2|04515
Ophiocordyceps camponoti-rufipedis Ophun1|5636
Ophiocordyceps kimflemingae Ophio5|186
Ophiocordyceps subramaniannii Hirsu2|608 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|608
MGIAILNGILTSLAERHGPKPLQTPSSSTSGTSTPAEELPQALPGRFIACVRSAESAKRVKAALWEHSSVVTVVQ
RDNVAAARQADVVLLACKPYMADAVLAEPGMADALRGKLLVSVCAGVTADQMERALHGEPSSSLSSSSSSSRPDP
AEDGRCRVVRAMCNTAALIRESMTVIGLTDPPLPPQLKTLVTWIFRRVGDVVYLPASTMDASTALVGSAPAMFAL
MLEAAIDGAVAMGLPRAEAQRMATQAMRGTTGLVQAGEHPAILREKVSTPGGCTIGGLLVLEEGRARGTIARAIR
EATCVASQLGKGVQGVNGTRFSTTPQQD*
Coding >Hirsu2|608
ATGGGCATCGCCATCCTCAACGGCATCCTCACCTCGCTCGCGGAGCGGCACGGGCCGAAGCCGCTGCAGACGCCG
TCGTCGTCGACGTCCGGCACCTCGACGCCGGCCGAGGAGCTGCCGCAGGCGCTGCCCGGGCGCTTCATCGCGTGC
GTGCGCAGCGCCGAGAGCGCGAAGCGGGTCAAGGCCGCGCTGTGGGAGCACTCGTCCGTCGTGACGGTCGTGCAG
CGGGACAACGTGGCGGCCGCGCGGCAGGCCGACGTCGTCCTGCTAGCCTGCAAGCCGTACATGGCGGACGCGGTG
CTGGCCGAGCCCGGCATGGCCGACGCCCTGCGCGGCAAGCTGCTCGTCAGCGTCTGCGCCGGCGTCACCGCCGAC
CAGATGGAGCGCGCCCTGCACGGCGAGCCGTCGTCGTCGTTGTCGTCGTCGTCGTCGTCGTCCCGGCCCGACCCG
GCCGAGGACGGCCGGTGCCGCGTCGTGCGCGCCATGTGCAACACCGCCGCCCTCATCCGCGAGTCCATGACCGTC
ATCGGCCTGACGGACCCCCCGCTGCCGCCGCAGCTCAAGACGCTCGTCACCTGGATCTTCAGGCGCGTCGGCGAC
GTCGTCTACCTGCCGGCCAGCACCATGGACGCCTCGACCGCCCTCGTCGGCTCCGCCCCGGCCATGTTCGCCCTC
ATGCTCGAGGCCGCCATCGACGGCGCCGTCGCCATGGGCCTGCCCCGGGCCGAGGCCCAGCGCATGGCCACCCAG
GCCATGAGGGGCACCACCGGCCTGGTCCAGGCCGGCGAGCATCCGGCCATCCTCCGGGAGAAGGTCTCCACGCCC
GGAGGCTGCACCATCGGCGGCCTGCTGGTCCTCGAGGAGGGCAGGGCCCGCGGCACCATCGCGAGAGCCATTCGC
GAGGCCACCTGCGTCGCCAGCCAGCTCGGCAAGGGCGTCCAAGGCGTCAATGGCACGCGGTTCAGCACGACTCCT
CAGCAAGATTAG
Transcript >Hirsu2|608
ATGGGCATCGCCATCCTCAACGGCATCCTCACCTCGCTCGCGGAGCGGCACGGGCCGAAGCCGCTGCAGACGCCG
TCGTCGTCGACGTCCGGCACCTCGACGCCGGCCGAGGAGCTGCCGCAGGCGCTGCCCGGGCGCTTCATCGCGTGC
GTGCGCAGCGCCGAGAGCGCGAAGCGGGTCAAGGCCGCGCTGTGGGAGCACTCGTCCGTCGTGACGGTCGTGCAG
CGGGACAACGTGGCGGCCGCGCGGCAGGCCGACGTCGTCCTGCTAGCCTGCAAGCCGTACATGGCGGACGCGGTG
CTGGCCGAGCCCGGCATGGCCGACGCCCTGCGCGGCAAGCTGCTCGTCAGCGTCTGCGCCGGCGTCACCGCCGAC
CAGATGGAGCGCGCCCTGCACGGCGAGCCGTCGTCGTCGTTGTCGTCGTCGTCGTCGTCGTCCCGGCCCGACCCG
GCCGAGGACGGCCGGTGCCGCGTCGTGCGCGCCATGTGCAACACCGCCGCCCTCATCCGCGAGTCCATGACCGTC
ATCGGCCTGACGGACCCCCCGCTGCCGCCGCAGCTCAAGACGCTCGTCACCTGGATCTTCAGGCGCGTCGGCGAC
GTCGTCTACCTGCCGGCCAGCACCATGGACGCCTCGACCGCCCTCGTCGGCTCCGCCCCGGCCATGTTCGCCCTC
ATGCTCGAGGCCGCCATCGACGGCGCCGTCGCCATGGGCCTGCCCCGGGCCGAGGCCCAGCGCATGGCCACCCAG
GCCATGAGGGGCACCACCGGCCTGGTCCAGGCCGGCGAGCATCCGGCCATCCTCCGGGAGAAGGTCTCCACGCCC
GGAGGCTGCACCATCGGCGGCCTGCTGGTCCTCGAGGAGGGCAGGGCCCGCGGCACCATCGCGAGAGCCATTCGC
GAGGCCACCTGCGTCGCCAGCCAGCTCGGCAAGGGCGTCCAAGGCGTCAATGGCACGCGGTTCAGCACGACTCCT
CAGCAAGATTAG
Gene >Hirsu2|608
ATGGGCATCGCCATCCTCAACGGCATCCTCACCTCGCTCGCGGAGCGGCACGGGCCGAAGCCGCTGCAGACGCCG
TCGTCGTCGACGTCCGGCACCTCGACGCCGGCCGAGGAGCTGCCGCAGGCGCTGCCCGGGCGCTTCATCGCGTGC
GTGCGCAGCGCCGAGAGCGCGAAGCGGGTCAAGGCCGCGCTGTGGGAGCACTCGTCCGTCGTGACGGTCGTGCAG
CGGGACAACGTGGCGGCCGCGCGGCAGGCCGACGTCGTCCTGCTAGCCTGCAAGCCGTACATGGCGGACGCGGTG
CTGGCCGAGCCCGGCATGGCCGACGCCCTGCGCGGCAAGCTGCTCGTCAGCGTCTGCGCCGGCGTCACCGCCGAC
CAGATGGAGCGCGCCCTGCACGGCGAGCCGTCGTCGTCGTTGTCGTCGTCGTCGTCGTCGTCCCGGCCCGACCCG
GCCGAGGACGGCCGGTGCCGCGTCGTGCGCGCCATGTGCAACACCGCCGCCCTCATCCGCGAGTCCATGACCGTC
ATCGGCCTGACGGACCCCCCGCTGCCGCCGCAGCTCAAGACGCTCGTCACCTGGATCTTCAGGCGCGTCGGCGAC
GTCGTCTACCTGCCGGCCAGCACCATGGACGCCTCGACCGCCCTCGTCGGCTCCGCCCCGGCCATGTTCGCCCTC
ATGCTCGAGGCCGCCATCGACGGCGCCGTCGCCATGGGCCTGCCCCGGGCCGAGGCCCAGCGCATGGCCACCCAG
GCCATGAGGGGCACCACCGGCCTGGTCCAGGCCGGCGAGCATCCGGCCATCCTCCGGGAGAAGGTCTCCACGCCC
GGAGGCTGCACCATCGGCGGCCTGCTGGTCCTCGAGGAGGGCAGGGCCCGCGGCACCATCGCGAGAGCCATTCGC
GAGGCCACCTGCGTCGCCAGCCAGCTCGGCAAGGGCGTCCAAGGCGTCAATGGCACGCGGTTCAGCACGACTCCT
CAGCAAGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail