Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6078
Gene name
LocationContig_308:1539..2561
Strand-
Gene length (bp)1022
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04719 TAFII28 hTAFII28-like protein conserved region 3.1E-32 171 284

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US54|TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf11 PE=3 SV=1 124 283 1.0E-18
sp|Q5RA91|TAF11_PONAB Transcription initiation factor TFIID subunit 11 OS=Pongo abelii GN=TAF11 PE=2 SV=1 163 290 3.0E-15
sp|Q5U1X0|TAF11_RAT Transcription initiation factor TFIID subunit 11 OS=Rattus norvegicus GN=Taf11 PE=1 SV=1 163 290 4.0E-15
sp|Q15544|TAF11_HUMAN Transcription initiation factor TFIID subunit 11 OS=Homo sapiens GN=TAF11 PE=1 SV=1 163 290 4.0E-15
sp|Q99JX1|TAF11_MOUSE Transcription initiation factor TFIID subunit 11 OS=Mus musculus GN=Taf11 PE=2 SV=1 163 290 7.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US54|TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf11 PE=3 SV=1 124 283 1.0E-18
sp|Q5RA91|TAF11_PONAB Transcription initiation factor TFIID subunit 11 OS=Pongo abelii GN=TAF11 PE=2 SV=1 163 290 3.0E-15
sp|Q5U1X0|TAF11_RAT Transcription initiation factor TFIID subunit 11 OS=Rattus norvegicus GN=Taf11 PE=1 SV=1 163 290 4.0E-15
sp|Q15544|TAF11_HUMAN Transcription initiation factor TFIID subunit 11 OS=Homo sapiens GN=TAF11 PE=1 SV=1 163 290 4.0E-15
sp|Q99JX1|TAF11_MOUSE Transcription initiation factor TFIID subunit 11 OS=Mus musculus GN=Taf11 PE=2 SV=1 163 290 7.0E-15
sp|Q54XM9|TAF11_DICDI Transcription initiation factor TFIID subunit 11 OS=Dictyostelium discoideum GN=taf11 PE=3 SV=1 172 289 1.0E-11
sp|P49906|TAF11_DROME Transcription initiation factor TFIID subunit 11 OS=Drosophila melanogaster GN=Taf11 PE=1 SV=1 171 286 4.0E-10
sp|Q04226|TAF11_YEAST Transcription initiation factor TFIID subunit 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF11 PE=1 SV=1 84 242 2.0E-09
sp|A6NLC8|YE016_HUMAN Putative TAF11-like protein ENSP00000332601 OS=Homo sapiens PE=3 SV=2 164 289 4.0E-09
sp|Q9M565|TAF11_ARATH Transcription initiation factor TFIID subunit 11 OS=Arabidopsis thaliana GN=TAF11 PE=1 SV=1 172 300 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006367 transcription initiation from RNA polymerase II promoter Yes
GO:0005634 nucleus Yes
GO:0032774 RNA biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043229 intracellular organelle No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006352 DNA-templated transcription, initiation No
GO:0016070 RNA metabolic process No
GO:0005575 cellular_component No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0043226 organelle No
GO:0019438 aromatic compound biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:1901576 organic substance biosynthetic process No
GO:0044464 cell part No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044424 intracellular part No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0009987 cellular process No
GO:0043227 membrane-bounded organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6078
MASPPYASSPLAMSPPNPPAAQLPNKKRSSTLDVNAPPVKRRKPSNLSQASGPAHPLRQTSFPPEGRSPYARSPS
VDAASIVSGSAVSAVTAGGPAKKKRGRKAKAAKGDDATEKTPSLVGGKAPTAAGGQGGDKEGDDDDDEEEKEEMA
LEDVVARTQEQKQEEIRLRAMLVEAFDSEQYNRYELWRAAKLSDAVVKRVVNATVSQSVPQMVSTAVKAVAKLFA
GEIIEAARNVQGEWISAGERQSELPTPPPSTNGAGAGDEEAEAKRGPLRPDHLREAWRRYKVSGESYGVGVQQLW
HAQQGDGVDRFSTRTRKRLFK*
Coding >Hirsu2|6078
ATGGCTTCGCCGCCGTACGCATCGTCGCCCCTGGCCATGTCGCCGCCGAACCCGCCGGCGGCCCAGCTCCCCAAC
AAGAAGCGGTCGTCGACGCTCGACGTCAACGCGCCGCCCGTCAAGCGCCGCAAGCCGTCGAACCTGTCGCAGGCC
TCGGGCCCGGCGCACCCTCTGCGGCAGACGTCCTTCCCGCCCGAGGGCCGGTCTCCCTACGCGCGATCGCCGTCG
GTCGACGCGGCGTCCATCGTCAGCGGCAGCGCCGTCAGCGCCGTGACGGCCGGCGGCCCGGCCAAGAAGAAGCGC
GGGCGGAAAGCCAAGGCGGCCAAGGGCGACGACGCGACCGAGAAAACACCGAGCCTCGTCGGCGGCAAGGCCCCC
ACCGCGGCCGGCGGCCAGGGCGGGGACAAGGAAGGCGACGACGACGACGACGAAGAGGAGAAGGAGGAGATGGCG
TTGGAGGACGTGGTGGCGCGCACGCAAGAGCAGAAGCAGGAGGAGATCAGGCTGCGGGCGATGCTGGTCGAGGCC
TTTGACAGCGAGCAGTACAACCGATACGAGCTGTGGCGGGCGGCCAAGCTGTCCGACGCCGTCGTCAAGAGGGTC
GTCAACGCCACGGTGTCGCAGTCGGTCCCGCAGATGGTCAGCACGGCCGTCAAGGCCGTGGCCAAGCTGTTCGCC
GGCGAAATCATCGAGGCGGCGCGCAACGTCCAGGGCGAATGGATCTCGGCGGGCGAGAGGCAGTCGGAGCTGCCG
ACGCCGCCGCCGTCGACCAACGGCGCGGGCGCGGGCGACGAAGAGGCAGAGGCGAAGCGAGGACCGCTGCGGCCG
GATCACCTGCGCGAGGCCTGGCGACGATACAAGGTCTCGGGCGAGAGCTACGGGGTGGGCGTGCAGCAGCTGTGG
CACGCACAGCAAGGCGACGGCGTCGACCGGTTTTCCACGCGGACCCGCAAGAGGCTGTTCAAGTGA
Transcript >Hirsu2|6078
ATGGCTTCGCCGCCGTACGCATCGTCGCCCCTGGCCATGTCGCCGCCGAACCCGCCGGCGGCCCAGCTCCCCAAC
AAGAAGCGGTCGTCGACGCTCGACGTCAACGCGCCGCCCGTCAAGCGCCGCAAGCCGTCGAACCTGTCGCAGGCC
TCGGGCCCGGCGCACCCTCTGCGGCAGACGTCCTTCCCGCCCGAGGGCCGGTCTCCCTACGCGCGATCGCCGTCG
GTCGACGCGGCGTCCATCGTCAGCGGCAGCGCCGTCAGCGCCGTGACGGCCGGCGGCCCGGCCAAGAAGAAGCGC
GGGCGGAAAGCCAAGGCGGCCAAGGGCGACGACGCGACCGAGAAAACACCGAGCCTCGTCGGCGGCAAGGCCCCC
ACCGCGGCCGGCGGCCAGGGCGGGGACAAGGAAGGCGACGACGACGACGACGAAGAGGAGAAGGAGGAGATGGCG
TTGGAGGACGTGGTGGCGCGCACGCAAGAGCAGAAGCAGGAGGAGATCAGGCTGCGGGCGATGCTGGTCGAGGCC
TTTGACAGCGAGCAGTACAACCGATACGAGCTGTGGCGGGCGGCCAAGCTGTCCGACGCCGTCGTCAAGAGGGTC
GTCAACGCCACGGTGTCGCAGTCGGTCCCGCAGATGGTCAGCACGGCCGTCAAGGCCGTGGCCAAGCTGTTCGCC
GGCGAAATCATCGAGGCGGCGCGCAACGTCCAGGGCGAATGGATCTCGGCGGGCGAGAGGCAGTCGGAGCTGCCG
ACGCCGCCGCCGTCGACCAACGGCGCGGGCGCGGGCGACGAAGAGGCAGAGGCGAAGCGAGGACCGCTGCGGCCG
GATCACCTGCGCGAGGCCTGGCGACGATACAAGGTCTCGGGCGAGAGCTACGGGGTGGGCGTGCAGCAGCTGTGG
CACGCACAGCAAGGCGACGGCGTCGACCGGTTTTCCACGCGGACCCGCAAGAGGCTGTTCAAGTGA
Gene >Hirsu2|6078
ATGGCTTCGCCGCCGTACGCATCGTCGCCCCTGGCCATGTCGCCGCCGAACCCGCCGGCGGCCCAGCTCCCCAAC
AAGAAGCGGTCGTCGACGCTCGACGTCAACGCGCCGCCCGTCAAGCGCCGCAAGCCGTCGAACCTGTCGCAGGCC
TCGGGCCCGGCGCACCCTCTGCGGCAGACGTCCTTCCCGCCCGAGGGCCGGTCTCCCTACGCGCGATCGCCGTCG
GTCGACGCGGCGTCCATCGTCAGCGGCAGCGCCGTCAGCGCCGTGACGGCCGGCGGCCCGGCCAAGAAGAAGCGC
GGGCGGAAAGCCAAGGCGGCCAAGGGCGACGACGCGACCGAGAAAACACCGAGCCTCGTCGGCGGCAAGGCCCCC
ACCGCGGCCGGCGGCCAGGGCGGGGACAAGGAAGGCGACGACGACGACGACGAAGAGGAGAAGGAGGAGATGGCG
TTGGAGGACGTGGTGGCGCGCACGCAAGAGCAGAAGCAGGAGGAGATCAGGCTGCGGGCGATGCTGGTCGAGGCC
TTTGACAGCGAGCAGTACAACCGATACGAGCTGTGGCGGGCGGCCAAGCTGTCCGACGCCGTCGTCAAGAGGGTA
CGCCTTTGTTTCCTTCTTCCTGCTCGGCAGGGCTGACGGGGAGAAACGAACAGGTCGTCAACGCCACGGTGTCGC
AGTCGGTCCCGCAGATGGTCAGCACGGCCGTCAAGGCCGTGGCCAAGCTGTTCGCCGGCGAAATCATCGAGGCGG
CGCGCAACGTCCAGGGCGAATGGATCTCGGCGGGCGAGAGGCAGTCGGAGCTGCCGACGCCGCCGCCGTCGACCA
ACGGCGCGGGCGCGGGCGACGAAGAGGCAGAGGCGAAGCGAGGACCGCTGCGGCCGGATCACCTGCGCGAGGCCT
GGCGACGATACAAGGTCTCGGGCGAGAGCTACGGGGTGGGCGTGCAGCAGCTGTGGCACGCACAGCAAGGCGACG
GCGTCGACCGGTTTTCCACGCGGACCCGCAAGAGGCTGTTCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail