Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6076
Gene name
LocationContig_3078:697..1115
Strand+
Gene length (bp)418
Transcript length (bp)324
Coding sequence length (bp)324
Protein length (aa) 108

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20238 DUF6595 Family of unknown function (DUF6595) 2.1E-14 34 95

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.4127 0.2019 0.6052 0.1774 0.2898 0.0849 0.2651 0.3186 0.3537 0.0415

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup337
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|1921
Ophiocordyceps camponoti-floridani Ophcf2|03744
Ophiocordyceps camponoti-floridani Ophcf2|05312
Ophiocordyceps camponoti-rufipedis Ophun1|4115
Ophiocordyceps camponoti-rufipedis Ophun1|5809
Ophiocordyceps kimflemingae Ophio5|388
Ophiocordyceps kimflemingae Ophio5|8115
Ophiocordyceps subramaniannii Hirsu2|409
Ophiocordyceps subramaniannii Hirsu2|6076 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6076
MRPPPYALLGPLWATVSAVDAVEKRHYFGPSRHMGPAGFLWPPGRAWSADADNTAPCGSTAGAGNRTQFPLRNGR
VVLVTQDESWDAVLSISYQAGERSPSPGGGCD*
Coding >Hirsu2|6076
ATGCGACCGCCCCCATACGCGCTGCTCGGCCCGCTCTGGGCCACGGTTTCGGCCGTCGACGCGGTCGAGAAGAGG
CACTACTTCGGCCCGTCGCGGCACATGGGCCCCGCCGGCTTCCTGTGGCCGCCGGGCCGGGCCTGGTCCGCCGAC
GCCGACAACACGGCCCCGTGCGGCTCCACCGCCGGCGCCGGGAACCGGACCCAGTTCCCGCTGCGCAACGGACGG
GTCGTGCTGGTAACCCAGGACGAGTCTTGGGACGCCGTGCTGAGCATCTCGTACCAGGCTGGTGAGAGAAGCCCG
TCCCCCGGAGGAGGATGCGACTGA
Transcript >Hirsu2|6076
ATGCGACCGCCCCCATACGCGCTGCTCGGCCCGCTCTGGGCCACGGTTTCGGCCGTCGACGCGGTCGAGAAGAGG
CACTACTTCGGCCCGTCGCGGCACATGGGCCCCGCCGGCTTCCTGTGGCCGCCGGGCCGGGCCTGGTCCGCCGAC
GCCGACAACACGGCCCCGTGCGGCTCCACCGCCGGCGCCGGGAACCGGACCCAGTTCCCGCTGCGCAACGGACGG
GTCGTGCTGGTAACCCAGGACGAGTCTTGGGACGCCGTGCTGAGCATCTCGTACCAGGCTGGTGAGAGAAGCCCG
TCCCCCGGAGGAGGATGCGACTGA
Gene >Hirsu2|6076
ATGCGACCGCCCCCATACGCGCTGCTCGGCCCGCTCTGGGCCACGGTTTCGGCCGTCGACGCGGTCGAGAAGAGG
CACTACTTCGGCCCGTCGCGGCACATGGGCCCCGCCGGCTTCCTGTGGCCGCCGGGCCGGGCCTGGTCCGCCGAC
GCCGACAACACGGCCCCGTGCGGCTCCACCGCCGGCGCCGGGAACCGGACCCAGTTCCCGCTGCGTGAGTTTCTT
TCTTTCTTTCCTTTTTTGCCTCGCCGGAGCCGTGAGCTACCTATACCGGAGGCGCTCCGGGGCTGACCATATAAA
AACAACAGGCAACGGACGGGTCGTGCTGGTAACCCAGGACGAGTCTTGGGACGCCGTGCTGAGCATCTCGTACCA
GGCTGGTGAGAGAAGCCCGTCCCCCGGAGGAGGATGCGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail