Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6060
Gene name
LocationContig_307:2359..4014
Strand-
Gene length (bp)1655
Transcript length (bp)1599
Coding sequence length (bp)1599
Protein length (aa) 533

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20183 DUF6546 Family of unknown function (DUF6546) 1.0E-50 306 515

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6954 0.6473 0.0849 0.2716 0.1948 0.0114 0.0235 0.0919 0.0314 0.0044

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1171
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|6421
Ophiocordyceps subramaniannii Hirsu2|1028
Ophiocordyceps subramaniannii Hirsu2|1029
Ophiocordyceps subramaniannii Hirsu2|2484
Ophiocordyceps subramaniannii Hirsu2|2485
Ophiocordyceps subramaniannii Hirsu2|6060 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6060
MVEWSSLPFDIRLAIFEALAQNVLAVRPGKGRLDRPRMQKHGLSKYSLVCKEWQPFFEKQLYSNLTITKYSLYQF
RHLVVRQRALVKHIWLKIECETYECPWCVFNPNGNRKRKCAADDATARRAISGLLRTLADWDRDRVACPGSLTLE
ISAHSPSDLEHVFMNELYFDTSSWGIDELQHDAPLLNDIGHGWANGRRTQPQLWISLDRLFGHGHYTLPDFYCRL
PQVQLVGRFILRRQTRRTFHPESLTKLLQSFPNLNSVIYEPWRDLAASPYEEVEGDRPYWWTWSNGLLGRDLGYS
HVISESLPDTLRELTLFEDFNEDYLTIARIHRGYKADNGPVSPRKTPSRAVGRALAKRSIPLVRLSASYLVDAGE
FFRAVDPAWVWKSLVSLSLTSHHLVETLSADVSRLLVEAGTTALQMPQLRRMDIWNGSKGNAWIFSYEITDQHTM
IKWRGTWHLALDSDIRVADVWSKVAKLYTRRDLTVASGEILDKDSISSHAMAIQKLGLGEREVVHPVSLKQIEKE
TEGYWYK*
Coding >Hirsu2|6060
ATGGTCGAGTGGTCTAGCCTCCCGTTCGATATCCGGCTCGCCATCTTCGAGGCACTGGCTCAGAATGTGCTAGCC
GTCAGGCCGGGCAAAGGGCGGCTTGACAGACCACGAATGCAAAAGCACGGCTTGTCAAAGTACTCCCTCGTCTGC
AAGGAATGGCAACCCTTCTTCGAGAAGCAGCTTTACTCTAATCTCACCATTACCAAATACTCGCTTTATCAATTT
AGGCACCTGGTCGTCCGTCAGAGGGCACTTGTGAAGCACATCTGGCTAAAGATTGAGTGCGAGACATACGAATGC
CCCTGGTGTGTCTTCAATCCCAACGGTAACCGGAAACGCAAGTGTGCTGCCGACGATGCGACTGCTAGAAGGGCT
ATCTCCGGCCTCCTTCGGACGCTCGCCGACTGGGACCGTGACCGAGTCGCCTGTCCAGGTAGCTTGACGCTGGAG
ATTAGCGCCCATTCTCCAAGCGACCTTGAGCACGTTTTCATGAACGAGTTATACTTTGACACGAGCTCCTGGGGG
ATCGACGAGCTTCAACACGACGCCCCTCTCCTCAACGACATCGGCCACGGCTGGGCCAACGGCCGACGGACCCAA
CCGCAGCTGTGGATCAGCTTGGACCGACTCTTCGGCCATGGGCACTACACGCTGCCCGATTTTTACTGTCGTCTT
CCGCAGGTCCAACTCGTCGGACGATTCATTTTACGGCGGCAAACCCGACGCACATTTCATCCTGAATCGTTGACC
AAGCTTCTCCAGAGCTTTCCAAACCTCAACTCTGTGATATACGAGCCATGGCGGGACTTGGCCGCCTCTCCTTAC
GAGGAGGTTGAGGGGGACAGGCCGTACTGGTGGACATGGAGCAACGGCCTTTTGGGCAGAGATCTAGGCTACAGC
CATGTTATCTCGGAGTCTTTGCCCGATACGCTGAGAGAGTTGACGTTGTTCGAGGACTTCAACGAGGACTATCTC
ACTATTGCCCGCATCCATCGCGGCTATAAGGCGGACAACGGTCCAGTCAGTCCCCGAAAAACCCCGAGTCGGGCT
GTCGGCCGAGCTTTGGCAAAGAGAAGCATACCTCTAGTCCGCCTCTCTGCTTCTTATCTCGTCGACGCCGGAGAG
TTTTTTCGAGCAGTAGACCCAGCTTGGGTCTGGAAAAGTCTGGTATCGCTCTCATTGACGTCCCATCACTTGGTG
GAGACGCTCTCCGCAGACGTCTCCCGCCTCCTCGTGGAAGCTGGCACGACGGCCCTTCAGATGCCGCAGCTGAGG
AGGATGGATATATGGAATGGATCCAAGGGAAATGCCTGGATCTTTAGCTACGAGATCACAGATCAGCACACGATG
ATCAAGTGGCGCGGGACGTGGCATCTGGCCTTGGACTCTGATATCCGGGTCGCCGACGTCTGGAGCAAGGTCGCC
AAGCTCTACACGAGGCGGGACCTAACTGTTGCCAGCGGTGAGATCCTAGACAAGGACTCAATCAGCTCCCACGCT
ATGGCTATTCAGAAACTAGGTCTTGGCGAGCGAGAAGTTGTTCACCCAGTGTCATTGAAGCAGATTGAGAAGGAG
ACTGAGGGGTATTGGTATAAGTGA
Transcript >Hirsu2|6060
ATGGTCGAGTGGTCTAGCCTCCCGTTCGATATCCGGCTCGCCATCTTCGAGGCACTGGCTCAGAATGTGCTAGCC
GTCAGGCCGGGCAAAGGGCGGCTTGACAGACCACGAATGCAAAAGCACGGCTTGTCAAAGTACTCCCTCGTCTGC
AAGGAATGGCAACCCTTCTTCGAGAAGCAGCTTTACTCTAATCTCACCATTACCAAATACTCGCTTTATCAATTT
AGGCACCTGGTCGTCCGTCAGAGGGCACTTGTGAAGCACATCTGGCTAAAGATTGAGTGCGAGACATACGAATGC
CCCTGGTGTGTCTTCAATCCCAACGGTAACCGGAAACGCAAGTGTGCTGCCGACGATGCGACTGCTAGAAGGGCT
ATCTCCGGCCTCCTTCGGACGCTCGCCGACTGGGACCGTGACCGAGTCGCCTGTCCAGGTAGCTTGACGCTGGAG
ATTAGCGCCCATTCTCCAAGCGACCTTGAGCACGTTTTCATGAACGAGTTATACTTTGACACGAGCTCCTGGGGG
ATCGACGAGCTTCAACACGACGCCCCTCTCCTCAACGACATCGGCCACGGCTGGGCCAACGGCCGACGGACCCAA
CCGCAGCTGTGGATCAGCTTGGACCGACTCTTCGGCCATGGGCACTACACGCTGCCCGATTTTTACTGTCGTCTT
CCGCAGGTCCAACTCGTCGGACGATTCATTTTACGGCGGCAAACCCGACGCACATTTCATCCTGAATCGTTGACC
AAGCTTCTCCAGAGCTTTCCAAACCTCAACTCTGTGATATACGAGCCATGGCGGGACTTGGCCGCCTCTCCTTAC
GAGGAGGTTGAGGGGGACAGGCCGTACTGGTGGACATGGAGCAACGGCCTTTTGGGCAGAGATCTAGGCTACAGC
CATGTTATCTCGGAGTCTTTGCCCGATACGCTGAGAGAGTTGACGTTGTTCGAGGACTTCAACGAGGACTATCTC
ACTATTGCCCGCATCCATCGCGGCTATAAGGCGGACAACGGTCCAGTCAGTCCCCGAAAAACCCCGAGTCGGGCT
GTCGGCCGAGCTTTGGCAAAGAGAAGCATACCTCTAGTCCGCCTCTCTGCTTCTTATCTCGTCGACGCCGGAGAG
TTTTTTCGAGCAGTAGACCCAGCTTGGGTCTGGAAAAGTCTGGTATCGCTCTCATTGACGTCCCATCACTTGGTG
GAGACGCTCTCCGCAGACGTCTCCCGCCTCCTCGTGGAAGCTGGCACGACGGCCCTTCAGATGCCGCAGCTGAGG
AGGATGGATATATGGAATGGATCCAAGGGAAATGCCTGGATCTTTAGCTACGAGATCACAGATCAGCACACGATG
ATCAAGTGGCGCGGGACGTGGCATCTGGCCTTGGACTCTGATATCCGGGTCGCCGACGTCTGGAGCAAGGTCGCC
AAGCTCTACACGAGGCGGGACCTAACTGTTGCCAGCGGTGAGATCCTAGACAAGGACTCAATCAGCTCCCACGCT
ATGGCTATTCAGAAACTAGGTCTTGGCGAGCGAGAAGTTGTTCACCCAGTGTCATTGAAGCAGATTGAGAAGGAG
ACTGAGGGGTATTGGTATAAGTGA
Gene >Hirsu2|6060
ATGGTCGAGTGGTCTAGCCTCCCGTTCGATATCCGGCTCGCCATCTTCGAGGCACTGGCTCAGAATGTGCTAGCC
GTCAGGCCGGGCAAAGGGCGGCTTGACAGACCACGAATGCAAAAGCACGGCTTGTCAAAGTACTCCCTCGTCTGC
AAGGAATGGCAACCCTTCTTCGAGAAGCAGCTTTACTCTAATCTCACCATTACCAAATACTCGCTTTATCAATTT
AGGCACCTGGTCGTCCGTCAGAGGGCACTTGTGAAGCACATCTGGCTAAAGATTGAGTGCGAGACATACGAATGC
CCCTGGTGTGTCTTCAATCCCAACGGTAACCGGAAACGCAAGTGTGCTGCCGACGATGCGACTGCTAGAAGGGCT
ATCTCCGGCCTCCTTCGGACGCTCGCCGACTGGGACCGTGACCGAGTCGCCTGTCCAGGTAGCTTGACGCTGGAG
ATTAGCGCCCATTCTCCAAGCGACCTTGAGCACGTTTTCATGAACGAGTTATACTTTGACACGAGCTCCTGGGGG
ATCGACGAGCTTCAACACGACGCCCCTCTCCTCAACGACATCGGCCACGGCTGGGCCAACGGCCGACGGACCCAA
CCGCAGCTGTGGATCAGCTTGGACCGACTCTTCGGCCATGGGCACTACACGCTGCCCGATTTTTACTGTCGTCTT
CCGCAGGTCCAACTCGTCGGACGATTCATTTTACGGCGGCAAACCCGACGCACATTTCATCCTGAATCGTTGACC
AAGCTTCTCCAGAGCTTTCCAAACCTCAACTCTGTGATATACGAGCCATGGCGGGACTTGGCCGCCTCTCCTTAC
GAGGAGGTTGAGGGGGACAGGCCGTACTGGTGGACATGGAGCAACGGCCTTTTGGGCAGAGATCTAGGTACGCGC
CTTGTTGTCGCATGCAAGACTTAGACACTGACCAATCATGTTGTGTAGGCTACAGCCATGTTATCTCGGAGTCTT
TGCCCGATACGCTGAGAGAGTTGACGTTGTTCGAGGACTTCAACGAGGACTATCTCACTATTGCCCGCATCCATC
GCGGCTATAAGGCGGACAACGGTCCAGTCAGTCCCCGAAAAACCCCGAGTCGGGCTGTCGGCCGAGCTTTGGCAA
AGAGAAGCATACCTCTAGTCCGCCTCTCTGCTTCTTATCTCGTCGACGCCGGAGAGTTTTTTCGAGCAGTAGACC
CAGCTTGGGTCTGGAAAAGTCTGGTATCGCTCTCATTGACGTCCCATCACTTGGTGGAGACGCTCTCCGCAGACG
TCTCCCGCCTCCTCGTGGAAGCTGGCACGACGGCCCTTCAGATGCCGCAGCTGAGGAGGATGGATATATGGAATG
GATCCAAGGGAAATGCCTGGATCTTTAGCTACGAGATCACAGATCAGCACACGATGATCAAGTGGCGCGGGACGT
GGCATCTGGCCTTGGACTCTGATATCCGGGTCGCCGACGTCTGGAGCAAGGTCGCCAAGCTCTACACGAGGCGGG
ACCTAACTGTTGCCAGCGGTGAGATCCTAGACAAGGACTCAATCAGCTCCCACGCTATGGCTATTCAGAAACTAG
GTCTTGGCGAGCGAGAAGTTGTTCACCCAGTGTCATTGAAGCAGATTGAGAAGGAGACTGAGGGGTATTGGTATA
AGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail