Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6059
Gene name
LocationContig_3067:47..507
Strand+
Gene length (bp)460
Transcript length (bp)348
Coding sequence length (bp)348
Protein length (aa) 116

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 4.8E-25 1 102

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 1 74 2.0E-14
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 1 74 6.0E-14
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 1 67 1.0E-13
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 1 74 1.0E-13
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 1 74 1.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 1 74 2.0E-14
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 1 74 6.0E-14
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 1 67 1.0E-13
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 1 74 1.0E-13
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 1 74 1.0E-13
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 1 74 2.0E-13
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 1 67 2.0E-13
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 1 107 2.0E-13
sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 1 74 3.0E-13
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 1 74 3.0E-13
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 1 113 4.0E-13
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 1 67 4.0E-13
sp|Q1ZXA4|C508D_DICDI Probable cytochrome P450 508D1 OS=Dictyostelium discoideum GN=cyp508D1 PE=3 SV=1 1 106 5.0E-13
sp|Q9VXY0|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 1 76 5.0E-13
sp|Q9V6H1|CP9H1_DROME Probable cytochrome P450 9h1 OS=Drosophila melanogaster GN=Cyp9h1 PE=3 SV=1 4 87 6.0E-13
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 1 67 8.0E-13
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 1 74 8.0E-13
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 1 67 9.0E-13
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 1 74 1.0E-12
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 1 67 1.0E-12
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 1 74 1.0E-12
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 1 72 2.0E-12
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 1 74 2.0E-12
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 1 74 2.0E-12
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 1 67 2.0E-12
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 1 86 2.0E-12
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 1 67 3.0E-12
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 1 82 4.0E-12
sp|Q9V9L1|CP6W1_DROME Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 1 69 5.0E-12
sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 1 68 6.0E-12
sp|Q9AXH9|KAO1_HORVU Ent-kaurenoic acid oxidase 1 OS=Hordeum vulgare GN=KAO1 PE=1 SV=1 1 78 7.0E-12
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 1 74 8.0E-12
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 1 82 9.0E-12
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 1 67 9.0E-12
sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 1 74 1.0E-11
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 1 74 1.0E-11
sp|Q9VRB3|CP6V1_DROME Probable cytochrome P450 6v1 OS=Drosophila melanogaster GN=Cyp6v1 PE=2 SV=1 4 70 1.0E-11
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 1 74 1.0E-11
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 1 68 1.0E-11
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 1 78 2.0E-11
sp|P13584|CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 1 74 2.0E-11
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 1 67 3.0E-11
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 1 67 3.0E-11
sp|Q27698|CP6D1_MUSDO Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 1 74 3.0E-11
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 4 74 3.0E-11
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 4 72 3.0E-11
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 1 67 4.0E-11
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 1 67 4.0E-11
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 1 67 4.0E-11
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 4 72 4.0E-11
sp|Q43246|C88A1_MAIZE Cytochrome P450 88A1 OS=Zea mays GN=CYP88A1 PE=2 SV=1 1 82 4.0E-11
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 1 74 4.0E-11
sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 1 101 5.0E-11
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 1 67 5.0E-11
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 1 74 5.0E-11
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 4 68 5.0E-11
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 1 74 6.0E-11
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 1 74 6.0E-11
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 1 74 7.0E-11
sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 1 63 7.0E-11
sp|O17624|C13B1_CAEEL Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 4 70 7.0E-11
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 4 69 9.0E-11
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 1 74 9.0E-11
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 1 64 9.0E-11
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 4 68 1.0E-10
sp|Q9C5Y2|KAO2_ARATH Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana GN=KAO2 PE=2 SV=2 1 74 1.0E-10
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 1 68 1.0E-10
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 1 74 1.0E-10
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 4 69 1.0E-10
sp|O23051|KAO1_ARATH Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 1 78 1.0E-10
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 1 74 1.0E-10
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 1 76 1.0E-10
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 1 63 1.0E-10
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 1 74 1.0E-10
sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 1 100 1.0E-10
sp|B9DFU2|MAX1_ARATH Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 1 71 2.0E-10
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 1 74 2.0E-10
sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 1 77 2.0E-10
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 1 83 2.0E-10
sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 1 83 2.0E-10
sp|Q9VCW1|CP6D4_DROME Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 1 94 2.0E-10
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 4 69 2.0E-10
sp|Q64658|C11B2_MESAU Cytochrome P450 11B2, mitochondrial OS=Mesocricetus auratus GN=CYP11B2 PE=2 SV=1 1 100 2.0E-10
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 1 74 2.0E-10
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 1 74 2.0E-10
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 1 74 2.0E-10
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 1 78 3.0E-10
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 1 74 3.0E-10
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 1 74 4.0E-10
sp|P9WPN3|CP132_MYCTU Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 4 63 5.0E-10
sp|Q964R0|CP6K1_BLAGE Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 14 74 5.0E-10
sp|P9WPN2|CP132_MYCTO Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 4 63 5.0E-10
sp|P59954|CP132_MYCBO Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 4 63 5.0E-10
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 1 67 5.0E-10
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 4 83 6.0E-10
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 1 78 7.0E-10
sp|B9GBJ9|C14C1_ORYSJ Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 1 74 7.0E-10
sp|Q9VRI9|CP6T1_DROME Probable cytochrome P450 6t1 OS=Drosophila melanogaster GN=Cyp6t1 PE=2 SV=1 1 74 7.0E-10
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 1 74 7.0E-10
sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 1 63 8.0E-10
sp|Q9VMS9|C4AC1_DROME Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 1 68 9.0E-10
sp|Q9VB31|C6A18_DROME Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 1 68 9.0E-10
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 1 74 1.0E-09
sp|Q964Q7|CP6D3_MUSDO Cytochrome P450 6d3 OS=Musca domestica GN=CYP6D3 PE=2 SV=1 5 74 1.0E-09
sp|Q9V7G5|C4AA1_DROME Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 1 74 1.0E-09
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 1 74 1.0E-09
sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 1 69 1.0E-09
sp|Q9VQD2|CP391_DROME Probable cytochrome P450 309a1 OS=Drosophila melanogaster GN=Cyp309a1 PE=1 SV=4 1 69 1.0E-09
sp|Q9QZ82|CP11A_MOUSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus GN=Cyp11a1 PE=1 SV=1 1 63 1.0E-09
sp|Q9V559|CP4P3_DROME Probable cytochrome P450 4p3 OS=Drosophila melanogaster GN=Cyp4p3 PE=2 SV=3 1 65 2.0E-09
sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 1 69 2.0E-09
sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 1 72 2.0E-09
sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 1 68 2.0E-09
sp|P97720|C11B1_MESAU Cytochrome P450 11B1, mitochondrial OS=Mesocricetus auratus GN=CYP11B1 PE=2 SV=1 1 100 2.0E-09
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 1 67 2.0E-09
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 1 74 2.0E-09
sp|Q9V771|C6A23_DROME Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 4 70 2.0E-09
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 1 74 2.0E-09
sp|Q6NKZ8|C14A2_ARATH Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 1 68 2.0E-09
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 1 74 3.0E-09
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 1 68 3.0E-09
sp|P9WPM3|CP138_MYCTU Putative cytochrome P450 138 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp138 PE=1 SV=1 1 72 3.0E-09
sp|P9WPM2|CP138_MYCTO Putative cytochrome P450 138 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp138 PE=3 SV=1 1 72 3.0E-09
sp|P63718|CP138_MYCBO Putative cytochrome P450 138 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp138 PE=3 SV=1 1 72 3.0E-09
sp|Q12586|CP52I_CANMA Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 4 62 3.0E-09
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 1 74 4.0E-09
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 1 74 4.0E-09
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 1 80 4.0E-09
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 4 76 5.0E-09
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 1 74 5.0E-09
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 1 83 5.0E-09
sp|I7CT85|C7A53_PANGI Protopanaxadiol 6-hydroxylase OS=Panax ginseng PE=1 SV=1 1 83 5.0E-09
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 1 67 5.0E-09
sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 4 83 5.0E-09
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 1 74 5.0E-09
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 1 76 5.0E-09
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 1 74 5.0E-09
sp|P15539|C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 1 100 6.0E-09
sp|Q29552|C11B1_PIG Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 1 100 6.0E-09
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 1 68 6.0E-09
sp|Q9W223|CP6D2_DROME Probable cytochrome P450 6d2 OS=Drosophila melanogaster GN=Cyp6d2 PE=2 SV=1 1 74 6.0E-09
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 1 74 6.0E-09
sp|Q12732|AVNA_ASPPA Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 1 98 6.0E-09
sp|Q9VL92|CP4E3_DROME Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 1 89 7.0E-09
sp|P51589|CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 1 63 7.0E-09
sp|Q7KWN2|C525A_DICDI Probable cytochrome P450 525A1 OS=Dictyostelium discoideum GN=cyp525A1 PE=3 SV=1 1 74 7.0E-09
sp|Q12573|CP52W_CANAP Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1 1 62 7.0E-09
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 1 74 9.0E-09
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 1 83 9.0E-09
sp|Q9W130|CP9C1_DROME Cytochrome P450 9c1 OS=Drosophila melanogaster GN=Cyp9c1 PE=2 SV=1 14 74 1.0E-08
sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 1 72 1.0E-08
sp|P00189|CP11A_BOVIN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus GN=CYP11A1 PE=1 SV=1 1 74 1.0E-08
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 1 74 1.0E-08
sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 3 69 1.0E-08
sp|O44221|CP4E5_DROMT Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 1 74 1.0E-08
sp|Q12612|TRI4_FUSSP Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 1 74 1.0E-08
sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 1 71 1.0E-08
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 1 70 1.0E-08
sp|O18596|C4D10_DROMT Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 1 74 2.0E-08
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 1 68 2.0E-08
sp|Q9JKJ9|CP39A_MOUSE 24-hydroxycholesterol 7-alpha-hydroxylase OS=Mus musculus GN=Cyp39a1 PE=1 SV=1 1 67 2.0E-08
sp|Q9V3S0|CP4G1_DROME Cytochrome P450 4g1 OS=Drosophila melanogaster GN=Cyp4g1 PE=2 SV=1 1 68 2.0E-08
sp|P43083|CP52V_CANAP Cytochrome P450 52E1 OS=Candida apicola GN=CYP52E1 PE=3 SV=1 1 62 2.0E-08
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 1 74 2.0E-08
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 1 74 2.0E-08
sp|Q9V770|C6A17_DROME Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 4 70 3.0E-08
sp|P11715|CP17A_RAT Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 1 100 3.0E-08
sp|Q9NYL5|CP39A_HUMAN 24-hydroxycholesterol 7-alpha-hydroxylase OS=Homo sapiens GN=CYP39A1 PE=2 SV=2 1 67 3.0E-08
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 1 74 3.0E-08
sp|Q9VYY4|C4G15_DROME Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 1 68 3.0E-08
sp|Q9Y758|CP52M_DEBHN Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 4 74 3.0E-08
sp|P79202|CP11A_SHEEP Cholesterol side-chain cleavage enzyme, mitochondrial OS=Ovis aries GN=CYP11A1 PE=1 SV=1 1 74 3.0E-08
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 1 74 3.0E-08
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 1 74 3.0E-08
sp|Q9V4I1|CP9B2_DROME Cytochrome P450 9b2 OS=Drosophila melanogaster GN=Cyp9b2 PE=2 SV=1 14 74 3.0E-08
sp|P79153|CP11A_CAPHI Cholesterol side-chain cleavage enzyme, mitochondrial OS=Capra hircus GN=CYP11A1 PE=2 SV=1 1 74 3.0E-08
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 1 74 3.0E-08
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 1 74 3.0E-08
sp|Q2QYH7|C14C2_ORYSJ Cytochrome P450 714C2 OS=Oryza sativa subsp. japonica GN=CYP714C2 PE=2 SV=1 1 62 4.0E-08
sp|P82711|C6A19_DROME Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 1 68 4.0E-08
sp|Q27593|CP6A8_DROME Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 1 68 4.0E-08
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 1 82 4.0E-08
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 4 62 4.0E-08
sp|D4AY62|A1131_ARTBC Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 4 74 4.0E-08
sp|P11711|CP2A1_RAT Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 1 75 5.0E-08
sp|Q9VFJ0|CA131_DROME Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 1 67 5.0E-08
sp|Q93Z79|C14A1_ARATH Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1 1 68 5.0E-08
sp|Q07217|CP11A_ONCMY Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 1 74 5.0E-08
sp|Q9V557|CP4P2_DROME Probable cytochrome P450 4p2 OS=Drosophila melanogaster GN=Cyp4p2 PE=2 SV=1 1 65 5.0E-08
sp|Q9EPT4|CP11A_MESAU Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mesocricetus auratus GN=CYP11A1 PE=2 SV=1 1 63 6.0E-08
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 1 74 6.0E-08
sp|Q9VFP1|CP6D5_DROME Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 4 68 6.0E-08
sp|F4JW83|C84A4_ARATH Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 1 91 7.0E-08
sp|P82713|CP392_DROME Probable cytochrome P450 309a2 OS=Drosophila melanogaster GN=Cyp309a2 PE=2 SV=2 4 82 7.0E-08
sp|P51663|C11B1_SHEEP Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 1 100 8.0E-08
sp|Q27606|CP4E2_DROME Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 1 87 8.0E-08
sp|P52786|CP2J1_RABIT Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 1 63 8.0E-08
sp|Q2KIG5|THAS_BOVIN Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 1 55 8.0E-08
sp|P9WPM9|C135B_MYCTU Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135B1 PE=1 SV=1 1 115 8.0E-08
sp|P9WPM8|C135B_MYCTO Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135B1 PE=3 SV=1 1 115 8.0E-08
sp|P63716|C135B_MYCBO Putative cytochrome P450 135B1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp135B1 PE=3 SV=1 1 115 8.0E-08
sp|Q09660|CC44_CAEEL Probable cytochrome P450 CYP44 OS=Caenorhabditis elegans GN=cyp-44A1 PE=3 SV=2 1 68 8.0E-08
sp|P15150|C11B1_BOVIN Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 1 100 9.0E-08
sp|H2DH24|C7D47_PANGI Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 1 74 9.0E-08
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 1 74 1.0E-07
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 1 74 1.0E-07
sp|Q9V674|CP6G1_DROME Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 1 62 1.0E-07
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 1 75 1.0E-07
sp|Q6XVG2|CP254_MOUSE Cytochrome P450 2C54 OS=Mus musculus GN=Cyp2c54 PE=1 SV=1 1 63 1.0E-07
sp|P30610|CP52H_CANTR Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 4 62 1.0E-07
sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 1 63 1.0E-07
sp|P79402|CP242_PIG Cytochrome P450 2C42 (Fragment) OS=Sus scrofa GN=CYP2C42 PE=2 SV=1 1 63 1.0E-07
sp|Q64408|C11B1_CAVPO Cytochrome P450 11B1, mitochondrial OS=Cavia porcellus GN=CYP11B1 PE=2 SV=1 1 100 1.0E-07
sp|Q948Y1|C719A_COPJA (S)-canadine synthase OS=Coptis japonica GN=CYP719A1 PE=1 SV=1 4 98 1.0E-07
sp|Q6YV88|C71Z7_ORYSJ Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 1 91 1.0E-07
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 1 68 2.0E-07
sp|Q42600|C84A1_ARATH Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 1 104 2.0E-07
sp|H1A981|C7263_MEDTR 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 1 68 2.0E-07
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 1 63 2.0E-07
sp|P14137|CP11A_RAT Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus GN=Cyp11a1 PE=2 SV=1 1 63 2.0E-07
sp|Q64429|CP1B1_MOUSE Cytochrome P450 1B1 OS=Mus musculus GN=Cyp1b1 PE=1 SV=3 1 63 2.0E-07
sp|P30100|C11B3_RAT Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus GN=Cyp11b3 PE=1 SV=1 1 62 2.0E-07
sp|Q59990|CP120_SYNY3 Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 1 64 2.0E-07
sp|P30099|C11B2_RAT Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus GN=Cyp11b2 PE=1 SV=1 1 62 2.0E-07
sp|Q9LTM1|C71BM_ARATH Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=CYP71B22 PE=2 SV=1 1 101 2.0E-07
sp|Q9V675|CP6G2_DROME Probable cytochrome P450 6g2 OS=Drosophila melanogaster GN=Cyp6g2 PE=2 SV=1 1 70 2.0E-07
sp|Q6WKZ0|C7D94_MENGR Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 1 90 2.0E-07
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 4 69 2.0E-07
sp|P24903|CP2F1_HUMAN Cytochrome P450 2F1 OS=Homo sapiens GN=CYP2F1 PE=1 SV=2 1 63 2.0E-07
sp|Q8WNE1|CP2F5_GORGO Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 1 63 2.0E-07
sp|O64989|C90B1_ARATH Cytochrome P450 90B1 OS=Arabidopsis thaliana GN=CYP90B1 PE=1 SV=2 1 74 2.0E-07
sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 1 63 2.0E-07
sp|Q91X77|CY250_MOUSE Cytochrome P450 2C50 OS=Mus musculus GN=Cyp2c50 PE=1 SV=2 1 63 2.0E-07
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 1 84 2.0E-07
sp|Q29527|C11B1_PAPHU Cytochrome P450 11B1, mitochondrial OS=Papio hamadryas ursinus GN=CYP11B1 PE=3 SV=1 1 56 2.0E-07
sp|Q5KQH7|C14D1_ORYSJ Cytochrome P450 714D1 OS=Oryza sativa subsp. japonica GN=CYP714D1 PE=1 SV=1 2 68 2.0E-07
sp|P15393|C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 1 62 2.0E-07
sp|P15538|C11B1_HUMAN Cytochrome P450 11B1, mitochondrial OS=Homo sapiens GN=CYP11B1 PE=1 SV=5 1 56 3.0E-07
sp|Q92045|CP11A_DASAM Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 1 74 3.0E-07
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 1 74 3.0E-07
sp|P27786|CP17A_MOUSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 1 63 3.0E-07
sp|Q12588|CP52J_CANMA Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 4 80 3.0E-07
sp|Q9V676|CP6T3_DROME Probable cytochrome P450 6t3 OS=Drosophila melanogaster GN=Cyp6t3 PE=3 SV=1 1 69 3.0E-07
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 1 113 3.0E-07
sp|Q9V558|CP4P1_DROME Cytochrome P450 4p1 OS=Drosophila melanogaster GN=Cyp4p1 PE=2 SV=1 1 65 3.0E-07
sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 4 102 3.0E-07
sp|Q9VVN6|CP312_DROME Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 1 74 3.0E-07
sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 1 74 3.0E-07
sp|Q9V419|C28A5_DROME Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 4 74 3.0E-07
sp|P10615|CP52A_CANTR Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 4 62 3.0E-07
sp|Q9V4T5|CP4E1_DROME Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 1 74 3.0E-07
sp|P11509|CP2A6_HUMAN Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 1 101 3.0E-07
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 1 91 3.0E-07
sp|Q9VMS7|C4AC3_DROME Probable cytochrome P450 4ac3 OS=Drosophila melanogaster GN=Cyp4ac3 PE=2 SV=2 1 68 3.0E-07
sp|Q27902|CP6B4_PAPGL Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 1 95 4.0E-07
sp|P10612|CP11A_PIG Cholesterol side-chain cleavage enzyme, mitochondrial OS=Sus scrofa GN=CYP11A1 PE=1 SV=1 1 74 4.0E-07
sp|Q9V4I0|CP9B1_DROME Cytochrome P450 9b1 OS=Drosophila melanogaster GN=Cyp9b1 PE=2 SV=1 14 74 4.0E-07
sp|Q9VWR2|CP308_DROME Probable cytochrome P450 308a1 OS=Drosophila melanogaster GN=Cyp308a1 PE=2 SV=2 4 67 4.0E-07
sp|Q9N0U7|CP17A_CAPHI Steroid 17-alpha-hydroxylase/17,20 lyase OS=Capra hircus GN=CYP17A1 PE=2 SV=1 4 84 4.0E-07
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 4 84 4.0E-07
sp|Q6VVX0|CP2R1_HUMAN Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 1 101 4.0E-07
sp|Q12587|CP52Q_CANMA Cytochrome P450 52C2 OS=Candida maltosa GN=CYP52C2 PE=2 SV=1 24 62 4.0E-07
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 1 101 5.0E-07
sp|Q29497|CP17A_SHEEP Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ovis aries GN=CYP17A1 PE=2 SV=2 4 84 5.0E-07
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 4 62 5.0E-07
sp|Q95036|CP6B5_PAPGL Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 1 74 5.0E-07
sp|Q0DS59|C14B2_ORYSJ Cytochrome P450 714B2 OS=Oryza sativa subsp. japonica GN=CYP714B2 PE=1 SV=2 1 68 5.0E-07
sp|F4IK45|C70B2_ARATH Cytochrome P450 709B2 OS=Arabidopsis thaliana GN=CYP709B2 PE=2 SV=1 1 68 5.0E-07
sp|Q5IZM4|CP51_MYCVP Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 4 64 5.0E-07
sp|Q96514|C71B7_ARATH Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 1 101 5.0E-07
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 1 74 5.0E-07
sp|P56594|CP2CL_CANLF Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 1 63 5.0E-07
sp|Q9VG82|CP9F2_DROME Probable cytochrome P450 9f2 OS=Drosophila melanogaster GN=Cyp9f2 PE=2 SV=1 4 72 5.0E-07
sp|O54749|CP2J5_MOUSE Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 1 63 6.0E-07
sp|P00181|CP2C2_RABIT Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 1 63 6.0E-07
sp|Q9GMC8|CP17A_FELCA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 4 76 7.0E-07
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 14 72 7.0E-07
sp|Q95328|CP17A_HORSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Equus caballus GN=CYP17A1 PE=2 SV=1 4 76 7.0E-07
sp|Q6F4F5|C724B_ORYSJ Cytochrome P450 724B1 OS=Oryza sativa subsp. japonica GN=CYP724B1 PE=1 SV=1 1 74 7.0E-07
sp|P15123|CP2CG_RABIT Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 1 63 7.0E-07
sp|Q50LH4|C7193_ESCCA (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 4 98 7.0E-07
sp|Q9FG65|C81D1_ARATH Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 1 83 7.0E-07
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 4 74 8.0E-07
sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 1 70 8.0E-07
sp|Q05JG2|ABAH1_ORYSJ Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP707A5 PE=2 SV=1 1 70 8.0E-07
sp|Q09J79|ABAH1_ORYSI Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa subsp. indica GN=CYP707A5 PE=2 SV=1 1 70 8.0E-07
sp|P08682|CP2E1_RABIT Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 1 107 8.0E-07
sp|Q8HYN1|CP17A_PANTR Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 4 85 9.0E-07
sp|O81077|ABAH2_ARATH Abscisic acid 8'-hydroxylase 2 OS=Arabidopsis thaliana GN=CYP707A2 PE=2 SV=1 1 85 9.0E-07
sp|O18809|CP2F3_CAPHI Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 1 63 9.0E-07
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 1 62 9.0E-07
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 1 74 9.0E-07
sp|Q8L7D5|THAH_ARATH Cytochrome P450 708A2 OS=Arabidopsis thaliana GN=CYP708A2 PE=2 SV=3 1 100 9.0E-07
sp|P00182|CP2C3_RABIT Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 1 72 1.0E-06
sp|P05093|CP17A_HUMAN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 4 85 1.0E-06
sp|Q6Z5I7|C76M6_ORYSJ Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 1 96 1.0E-06
sp|Q50LH3|C7192_ESCCA (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 4 74 1.0E-06
sp|P00180|CP2C1_RABIT Cytochrome P450 2C1 OS=Oryctolagus cuniculus GN=CYP2C1 PE=1 SV=2 1 63 1.0E-06
sp|Q9V769|C6A22_DROME Cytochrome P450 6a22 OS=Drosophila melanogaster GN=Cyp6a22 PE=2 SV=1 4 74 1.0E-06
sp|B6SSW8|C14B3_MAIZE Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 1 68 1.0E-06
sp|P05185|CP17A_BOVIN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bos taurus GN=CYP17A1 PE=2 SV=1 4 84 1.0E-06
sp|P15540|CP21A_PIG Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 1 74 1.0E-06
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 1 64 1.0E-06
sp|P20853|CP2A7_HUMAN Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 1 101 1.0E-06
sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 1 74 1.0E-06
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 4 69 1.0E-06
sp|Q6WNR0|C81E7_MEDTR Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 1 99 1.0E-06
sp|Q9GMC7|CP17A_BISBI Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bison bison GN=CYP17A1 PE=2 SV=1 4 84 1.0E-06
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 1 67 1.0E-06
sp|Q9GLD2|CP17A_PAPHU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1 4 76 2.0E-06
sp|Q8HYM9|CP17A_MACMU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 4 76 2.0E-06
sp|Q2XVA1|CP17A_MACFA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 4 76 2.0E-06
sp|Q8HYN0|CP17A_PAPCY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 4 76 2.0E-06
sp|P11371|CP2C4_RABIT Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 1 63 2.0E-06
sp|Q9V776|CP317_DROME Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 14 55 2.0E-06
sp|O04790|C75A7_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 1 61 2.0E-06
sp|Q6YTF5|C76M5_ORYSJ Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 1 96 2.0E-06
sp|P33261|CP2CJ_HUMAN Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 1 63 2.0E-06
sp|P56593|CP2AC_MOUSE Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 1 75 2.0E-06
sp|P70687|CP17A_MESAU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 1 76 2.0E-06
sp|P00179|CP2C5_RABIT Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 1 63 2.0E-06
sp|Q64410|CP17A_CAVPO Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 5 63 2.0E-06
sp|P56654|CP237_MOUSE Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 1 63 2.0E-06
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 1 74 2.0E-06
sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 1 74 3.0E-06
sp|P24460|CP2BB_CANLF Cytochrome P450 2B11 OS=Canis lupus familiaris GN=CYP2B11 PE=2 SV=1 1 77 3.0E-06
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 1 74 3.0E-06
sp|H2DH21|C7A29_PANGI Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 1 68 3.0E-06
sp|P90771|C36A1_CAEEL Probable cytochrome P450 CYP36A1 OS=Caenorhabditis elegans GN=cyp-36A1 PE=3 SV=2 1 63 4.0E-06
sp|Q949P1|ABAH1_ARATH Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1 1 85 5.0E-06
sp|O46515|CP11A_HORSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Equus caballus GN=CYP11A1 PE=3 SV=1 1 74 5.0E-06
sp|Q2LA60|CP21A_FELCA Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 1 74 5.0E-06
sp|P46373|FAS1_RHOFA Cytochrome P450 FAS1 OS=Rhodococcus fascians GN=fas1 PE=2 SV=1 1 80 5.0E-06
sp|Q2LA59|CP21A_LYNLY Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 1 74 5.0E-06
sp|O35293|CP2F2_RAT Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 1 63 5.0E-06
sp|P19099|C11B2_HUMAN Cytochrome P450 11B2, mitochondrial OS=Homo sapiens GN=CYP11B2 PE=1 SV=3 1 56 5.0E-06
sp|P93596|CP51_WHEAT Obtusifoliol 14-alpha demethylase (Fragment) OS=Triticum aestivum GN=CYP51 PE=2 SV=1 1 80 5.0E-06
sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 1 107 6.0E-06
sp|Q2LCM1|CP21A_CANLU Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 1 74 7.0E-06
sp|Q8WNW0|CP21A_CANLF Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 1 74 7.0E-06
sp|Q96SQ9|CP2S1_HUMAN Cytochrome P450 2S1 OS=Homo sapiens GN=CYP2S1 PE=1 SV=2 1 63 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0004497 monooxygenase activity Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0005506 iron ion binding Yes
GO:0020037 heme binding Yes
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0046914 transition metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6789 0.2518 0.2773 0.0898 0.2611 0.0378 0.1484 0.133 0.2931 0.0326

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup105
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1376
Ophiocordyceps australis 1348a (Ghana) OphauG2|5000
Ophiocordyceps australis map64 (Brazil) OphauB2|2330
Ophiocordyceps australis map64 (Brazil) OphauB2|6638
Ophiocordyceps camponoti-floridani Ophcf2|02415
Ophiocordyceps camponoti-floridani Ophcf2|05427
Ophiocordyceps camponoti-floridani Ophcf2|05428
Ophiocordyceps camponoti-rufipedis Ophun1|2176
Ophiocordyceps camponoti-rufipedis Ophun1|6758
Ophiocordyceps kimflemingae Ophio5|1176
Ophiocordyceps kimflemingae Ophio5|1177
Ophiocordyceps kimflemingae Ophio5|4504
Ophiocordyceps subramaniannii Hirsu2|6059 (this protein)
Ophiocordyceps subramaniannii Hirsu2|667
Ophiocordyceps subramaniannii Hirsu2|826
Ophiocordyceps subramaniannii Hirsu2|9048

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6059
LPAGTVVAAQAFTLHRDPAVFPAPDDFDPDRWEAPTKAMADAYMPFGRGPRICIGQHLALMELRTAVAHFYLAFP
DARVSTREGMSDDDMDEENYFVMSPRGKRCLIEADSATSS*
Coding >Hirsu2|6059
CTGCCCGCCGGCACCGTCGTCGCCGCCCAGGCCTTCACCCTGCACCGCGACCCGGCCGTCTTCCCGGCCCCGGAC
GACTTCGACCCGGACCGCTGGGAGGCCCCGACCAAGGCCATGGCCGACGCCTACATGCCGTTTGGGCGCGGGCCG
CGCATCTGCATCGGCCAGCACCTGGCCCTGATGGAGCTCCGGACCGCCGTCGCGCACTTCTACCTCGCCTTCCCG
GACGCGCGCGTGTCGACGCGCGAGGGCATGTCGGACGACGACATGGACGAGGAGAACTACTTCGTCATGTCGCCG
CGCGGCAAGCGCTGCCTCATCGAGGCCGACTCGGCCACCTCGAGCTGA
Transcript >Hirsu2|6059
CTGCCCGCCGGCACCGTCGTCGCCGCCCAGGCCTTCACCCTGCACCGCGACCCGGCCGTCTTCCCGGCCCCGGAC
GACTTCGACCCGGACCGCTGGGAGGCCCCGACCAAGGCCATGGCCGACGCCTACATGCCGTTTGGGCGCGGGCCG
CGCATCTGCATCGGCCAGCACCTGGCCCTGATGGAGCTCCGGACCGCCGTCGCGCACTTCTACCTCGCCTTCCCG
GACGCGCGCGTGTCGACGCGCGAGGGCATGTCGGACGACGACATGGACGAGGAGAACTACTTCGTCATGTCGCCG
CGCGGCAAGCGCTGCCTCATCGAGGCCGACTCGGCCACCTCGAGCTGA
Gene >Hirsu2|6059
CTGCCCGCCGGCACCGTCGTCGCCGCCCAGGCCTTCACCCTGCACCGCGACCCGGCCGTCTTCCCGGCCCCGGAC
GACTTCGACCCGGACCGCTGGGAGGCCCCGACCAAGGCCATGGCCGACGCCTACATGCCGTTTGGGCGCGGGCCG
CGCAGTGAGTCGTTTTCTCCTCTCCCCTTGCCGTCCTGTCGCGAGGCGCGCGCGGCGAGAGAGAACCGATGCCGA
TGCACACGTCTCACGCTCCGGCTGACCTTGCCCCCTGACAGTCTGCATCGGCCAGCACCTGGCCCTGATGGAGCT
CCGGACCGCCGTCGCGCACTTCTACCTCGCCTTCCCGGACGCGCGCGTGTCGACGCGCGAGGGCATGTCGGACGA
CGACATGGACGAGGAGAACTACTTCGTCATGTCGCCGCGCGGCAAGCGCTGCCTCATCGAGGCCGACTCGGCCAC
CTCGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail