Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6055
Gene name
LocationContig_306:21754..22560
Strand-
Gene length (bp)806
Transcript length (bp)684
Coding sequence length (bp)684
Protein length (aa) 228

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02015 Glyco_hydro_45 Glycosyl hydrolase family 45 1.1E-67 22 223

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P45699|GUNK_FUSOX Putative endoglucanase type K OS=Fusarium oxysporum PE=2 SV=1 4 225 2.0E-75
sp|P43316|GUN5_HUMIN Endoglucanase-5 OS=Humicola insolens PE=1 SV=1 23 225 5.0E-68
sp|O97401|GUN_PHACE Endoglucanase OS=Phaedon cochleariae PE=2 SV=1 19 224 4.0E-51
sp|P54424|GUN1_USTMA Endoglucanase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=EGL1 PE=2 SV=1 22 225 7.0E-32
sp|P18126|GUNB_CELJU Endoglucanase B OS=Cellvibrio japonicus (strain Ueda107) GN=celB PE=1 SV=1 23 225 8.0E-30

GO

GO Term Description Terminal node
GO:0008810 cellulase activity Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6055
MNPHSARLVILSLVVAVVLADSGVTTRYWDCCKPSCAWPGKAQVSEPVRTCGKNDLWPEPLDSNAQSACNGADAY
ACSNNGPWAVNDNLAYGFAAAKLAGQSEGNWCCACYELTFTSTSIAGKQMIVQVTNTGSDLGNNHFDLAFRGAGV
GIFPQGCQSQFDGTWMGDPYGGYRNRNDCYNLPSGMFRDGCFFRFDWFQNAQNPTVEFHEVSCPQAMIDRTHCAR
WS*
Coding >Hirsu2|6055
ATGAATCCACATTCAGCCCGTTTGGTTATTCTCTCGCTCGTGGTGGCTGTTGTCCTTGCCGACTCTGGTGTCACT
ACGCGATACTGGGACTGCTGCAAGCCCTCGTGCGCTTGGCCCGGTAAAGCGCAGGTATCGGAACCCGTGCGGACA
TGCGGAAAGAACGATCTTTGGCCGGAGCCGCTTGACTCCAATGCACAGTCGGCTTGCAATGGCGCCGACGCGTAC
GCATGCAGTAACAACGGACCATGGGCTGTCAACGATAACCTGGCGTACGGATTCGCGGCGGCCAAACTTGCTGGT
CAGTCCGAGGGTAATTGGTGCTGTGCTTGTTACGAACTCACATTCACTTCGACGTCGATTGCTGGGAAGCAAATG
ATCGTCCAGGTGACTAACACTGGTAGCGACCTAGGAAACAACCACTTCGATCTCGCCTTTCGCGGCGCCGGCGTG
GGCATATTTCCGCAAGGATGTCAATCGCAATTTGATGGCACGTGGATGGGTGACCCATACGGTGGTTACCGGAAC
AGGAATGATTGTTATAATCTTCCGTCGGGCATGTTCCGTGATGGCTGCTTCTTTCGTTTTGACTGGTTCCAGAAC
GCCCAGAACCCAACTGTCGAGTTTCATGAGGTGTCTTGTCCGCAGGCCATGATTGACAGGACGCACTGTGCTCGT
TGGAGTTGA
Transcript >Hirsu2|6055
ATGAATCCACATTCAGCCCGTTTGGTTATTCTCTCGCTCGTGGTGGCTGTTGTCCTTGCCGACTCTGGTGTCACT
ACGCGATACTGGGACTGCTGCAAGCCCTCGTGCGCTTGGCCCGGTAAAGCGCAGGTATCGGAACCCGTGCGGACA
TGCGGAAAGAACGATCTTTGGCCGGAGCCGCTTGACTCCAATGCACAGTCGGCTTGCAATGGCGCCGACGCGTAC
GCATGCAGTAACAACGGACCATGGGCTGTCAACGATAACCTGGCGTACGGATTCGCGGCGGCCAAACTTGCTGGT
CAGTCCGAGGGTAATTGGTGCTGTGCTTGTTACGAACTCACATTCACTTCGACGTCGATTGCTGGGAAGCAAATG
ATCGTCCAGGTGACTAACACTGGTAGCGACCTAGGAAACAACCACTTCGATCTCGCCTTTCGCGGCGCCGGCGTG
GGCATATTTCCGCAAGGATGTCAATCGCAATTTGATGGCACGTGGATGGGTGACCCATACGGTGGTTACCGGAAC
AGGAATGATTGTTATAATCTTCCGTCGGGCATGTTCCGTGATGGCTGCTTCTTTCGTTTTGACTGGTTCCAGAAC
GCCCAGAACCCAACTGTCGAGTTTCATGAGGTGTCTTGTCCGCAGGCCATGATTGACAGGACGCACTGTGCTCGT
TGGAGTTGA
Gene >Hirsu2|6055
ATGAATCCACATTCAGCCCGTTTGGTTATTCTCTCGCTCGTGGTGGCTGTTGTCCTTGCCGACTCTGGTGTCACT
ACGCGATACTGGGACTGCTGCAAGCCCTCGTGCGCTTGGCCCGGTAAAGCGCAGGTATCGGAACCCGTGCGGACA
TGCGGAAAGAACGATCTTTGGCCGGAGCCGCTTGACTCCAATGCACAGTCGGCTTGCAATGGCGCCGACGCGTAC
GCATGCAGTAACAACGGACCATGGGCTGTCAACGATAACCTGGCGTACGGATTCGCGGCGGCCAAACTTGCTGGT
CAGTCCGAGGGTAATTGGTGCTGTGCTTGTTACGAGTAAGTCTGAACCGTTTCTGAGATTTTTGACGAATAATCA
TACATTCCCACGGATCGCGAGGGCAGGTACAGCGATTGATTTGACTTGGTCTGACTGACATCCGGCAATGCCCAT
TTGATAGACTCACATTCACTTCGACGTCGATTGCTGGGAAGCAAATGATCGTCCAGGTGACTAACACTGGTAGCG
ACCTAGGAAACAACCACTTCGATCTCGCCTTTCGCGGCGCCGGCGTGGGCATATTTCCGCAAGGATGTCAATCGC
AATTTGATGGCACGTGGATGGGTGACCCATACGGTGGTTACCGGAACAGGAATGATTGTTATAATCTTCCGTCGG
GCATGTTCCGTGATGGCTGCTTCTTTCGTTTTGACTGGTTCCAGAACGCCCAGAACCCAACTGTCGAGTTTCATG
AGGTGTCTTGTCCGCAGGCCATGATTGACAGGACGCACTGTGCTCGTTGGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail