Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6052
Gene name
LocationContig_306:11314..11917
Strand-
Gene length (bp)603
Transcript length (bp)603
Coding sequence length (bp)603
Protein length (aa) 201

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00011 HSP20 Hsp20/alpha crystallin family 7.4E-09 139 199

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P19752|HSP30_NEUCR 30 kDa heat shock protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsp30 PE=3 SV=1 6 192 5.0E-40
sp|P40920|HSP30_EMENI 30 kDa heat shock protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hsp30 PE=2 SV=1 34 187 2.0E-27

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6052
MASSPGSVTSNPSVAHLVHLLQGINKYVHELGGLNDKQGHRHPEAAHGTFYPKFDVRELKDAFELYGELAGVQKK
DIIIEFSEPQTLVVRGFIERCYSTAKPAEQTAPGSSATPSTKDTDQGKQTPLTTAEKIPSPGARERDRARYWASE
RSIGEFSRIFIFPERVQQSGVTALLDGGILRVHIPKATKDETHGHRIEVD*
Coding >Hirsu2|6052
ATGGCGTCTTCTCCGGGGTCTGTTACCTCAAACCCCAGCGTTGCCCATCTTGTGCATCTCCTCCAAGGCATCAAT
AAGTATGTTCATGAACTAGGCGGCTTAAACGACAAACAAGGCCATCGTCACCCTGAGGCCGCACATGGCACATTT
TACCCTAAATTCGATGTGCGCGAATTGAAAGACGCGTTTGAGCTGTATGGGGAGCTTGCCGGTGTGCAAAAAAAG
GATATTATCATTGAGTTTTCCGAGCCCCAGACTCTGGTCGTCCGTGGGTTCATCGAGCGATGTTATTCCACAGCA
AAGCCGGCTGAACAAACGGCCCCCGGCAGCTCAGCTACACCGAGCACCAAGGATACTGATCAGGGTAAACAGACG
CCACTGACTACTGCCGAAAAGATTCCGAGTCCTGGAGCGCGGGAGCGTGATCGAGCCAGATACTGGGCATCTGAA
CGCAGCATCGGCGAGTTTTCACGGATATTTATATTTCCGGAGCGTGTTCAGCAGAGTGGTGTCACGGCCTTGCTC
GATGGCGGGATCCTCCGTGTCCATATTCCCAAGGCCACGAAGGATGAGACTCATGGGCATAGAATCGAAGTTGAC
TAG
Transcript >Hirsu2|6052
ATGGCGTCTTCTCCGGGGTCTGTTACCTCAAACCCCAGCGTTGCCCATCTTGTGCATCTCCTCCAAGGCATCAAT
AAGTATGTTCATGAACTAGGCGGCTTAAACGACAAACAAGGCCATCGTCACCCTGAGGCCGCACATGGCACATTT
TACCCTAAATTCGATGTGCGCGAATTGAAAGACGCGTTTGAGCTGTATGGGGAGCTTGCCGGTGTGCAAAAAAAG
GATATTATCATTGAGTTTTCCGAGCCCCAGACTCTGGTCGTCCGTGGGTTCATCGAGCGATGTTATTCCACAGCA
AAGCCGGCTGAACAAACGGCCCCCGGCAGCTCAGCTACACCGAGCACCAAGGATACTGATCAGGGTAAACAGACG
CCACTGACTACTGCCGAAAAGATTCCGAGTCCTGGAGCGCGGGAGCGTGATCGAGCCAGATACTGGGCATCTGAA
CGCAGCATCGGCGAGTTTTCACGGATATTTATATTTCCGGAGCGTGTTCAGCAGAGTGGTGTCACGGCCTTGCTC
GATGGCGGGATCCTCCGTGTCCATATTCCCAAGGCCACGAAGGATGAGACTCATGGGCATAGAATCGAAGTTGAC
TAG
Gene >Hirsu2|6052
ATGGCGTCTTCTCCGGGGTCTGTTACCTCAAACCCCAGCGTTGCCCATCTTGTGCATCTCCTCCAAGGCATCAAT
AAGTATGTTCATGAACTAGGCGGCTTAAACGACAAACAAGGCCATCGTCACCCTGAGGCCGCACATGGCACATTT
TACCCTAAATTCGATGTGCGCGAATTGAAAGACGCGTTTGAGCTGTATGGGGAGCTTGCCGGTGTGCAAAAAAAG
GATATTATCATTGAGTTTTCCGAGCCCCAGACTCTGGTCGTCCGTGGGTTCATCGAGCGATGTTATTCCACAGCA
AAGCCGGCTGAACAAACGGCCCCCGGCAGCTCAGCTACACCGAGCACCAAGGATACTGATCAGGGTAAACAGACG
CCACTGACTACTGCCGAAAAGATTCCGAGTCCTGGAGCGCGGGAGCGTGATCGAGCCAGATACTGGGCATCTGAA
CGCAGCATCGGCGAGTTTTCACGGATATTTATATTTCCGGAGCGTGTTCAGCAGAGTGGTGTCACGGCCTTGCTC
GATGGCGGGATCCTCCGTGTCCATATTCCCAAGGCCACGAAGGATGAGACTCATGGGCATAGAATCGAAGTTGAC
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail