Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6050
Gene name
LocationContig_306:4646..6326
Strand+
Gene length (bp)1680
Transcript length (bp)1680
Coding sequence length (bp)1680
Protein length (aa) 560

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 1.7E-37 5 170
PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain 2.2E-24 202 303
PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 2.5E-21 407 533

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33287|PDC_NEUCR Pyruvate decarboxylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cfp PE=1 SV=1 3 557 0.0E+00
sp|Q9P7P6|PDC3_SCHPO Probable pyruvate decarboxylase C186.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC186.09 PE=3 SV=1 5 557 0.0E+00
sp|Q92345|PDC2_SCHPO Probable pyruvate decarboxylase C1F8.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F8.07c PE=1 SV=3 2 557 0.0E+00
sp|P06672|PDC_ZYMMO Pyruvate decarboxylase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=pdc PE=1 SV=1 3 558 0.0E+00
sp|Q9M040|PDC4_ARATH Pyruvate decarboxylase 4 OS=Arabidopsis thaliana GN=PDC4 PE=2 SV=1 5 557 4.0E-155
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33287|PDC_NEUCR Pyruvate decarboxylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cfp PE=1 SV=1 3 557 0.0E+00
sp|Q9P7P6|PDC3_SCHPO Probable pyruvate decarboxylase C186.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC186.09 PE=3 SV=1 5 557 0.0E+00
sp|Q92345|PDC2_SCHPO Probable pyruvate decarboxylase C1F8.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F8.07c PE=1 SV=3 2 557 0.0E+00
sp|P06672|PDC_ZYMMO Pyruvate decarboxylase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=pdc PE=1 SV=1 3 558 0.0E+00
sp|Q9M040|PDC4_ARATH Pyruvate decarboxylase 4 OS=Arabidopsis thaliana GN=PDC4 PE=2 SV=1 5 557 4.0E-155
sp|Q9M039|PDC3_ARATH Pyruvate decarboxylase 3 OS=Arabidopsis thaliana GN=PDC3 PE=2 SV=1 5 557 8.0E-154
sp|O82647|PDC1_ARATH Pyruvate decarboxylase 1 OS=Arabidopsis thaliana GN=PDC1 PE=2 SV=1 5 557 2.0E-152
sp|Q9FFT4|PDC2_ARATH Pyruvate decarboxylase 2 OS=Arabidopsis thaliana GN=PDC2 PE=2 SV=1 5 557 2.0E-149
sp|P51850|PDC1_PEA Pyruvate decarboxylase 1 OS=Pisum sativum GN=PDC1 PE=2 SV=1 5 557 7.0E-148
sp|Q10MW3|PDC2_ORYSJ Pyruvate decarboxylase 2 OS=Oryza sativa subsp. japonica GN=PDC2 PE=2 SV=1 5 557 2.0E-147
sp|A2Y5L9|PDC1_ORYSI Pyruvate decarboxylase 1 OS=Oryza sativa subsp. indica GN=PDC1 PE=2 SV=1 2 557 4.0E-146
sp|A2XFI3|PDC2_ORYSI Pyruvate decarboxylase 2 OS=Oryza sativa subsp. indica GN=PDC2 PE=2 SV=2 5 557 1.0E-145
sp|Q0DHF6|PDC1_ORYSJ Pyruvate decarboxylase 1 OS=Oryza sativa subsp. japonica GN=PDC1 PE=2 SV=1 2 557 1.0E-145
sp|P51846|PDC2_TOBAC Pyruvate decarboxylase 2 OS=Nicotiana tabacum GN=PDC2 PE=2 SV=1 5 557 8.0E-144
sp|P28516|PDC1_MAIZE Pyruvate decarboxylase 1 OS=Zea mays GN=PDC1 PE=2 SV=1 6 557 3.0E-141
sp|Q0D3D2|PDC3_ORYSJ Pyruvate decarboxylase 3 OS=Oryza sativa subsp. japonica GN=PDC3 PE=2 SV=1 5 557 1.0E-138
sp|A2YQ76|PDC3_ORYSI Pyruvate decarboxylase 3 OS=Oryza sativa subsp. indica GN=PDC3 PE=3 SV=2 5 557 5.0E-138
sp|P51845|PDC1_TOBAC Pyruvate decarboxylase 1 (Fragment) OS=Nicotiana tabacum GN=PDC1 PE=2 SV=1 57 469 6.0E-103
sp|P51851|PDC2_PEA Pyruvate decarboxylase 2 (Fragment) OS=Pisum sativum GN=PDC2 PE=2 SV=1 161 557 2.0E-88
sp|P23234|DCIP_ENTCL Indole-3-pyruvate decarboxylase OS=Enterobacter cloacae GN=ipdC PE=1 SV=1 4 495 1.0E-82
sp|Q12629|PDC1_KLULA Pyruvate decarboxylase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PDC1 PE=1 SV=2 1 558 9.0E-75
sp|P26263|PDC6_YEAST Pyruvate decarboxylase isozyme 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDC6 PE=1 SV=3 1 558 2.0E-73
sp|A0QBE6|KDC_MYCA1 Alpha-keto-acid decarboxylase OS=Mycobacterium avium (strain 104) GN=kdc PE=3 SV=2 3 545 5.0E-73
sp|Q9CBD6|KDC_MYCLE Alpha-keto-acid decarboxylase OS=Mycobacterium leprae (strain TN) GN=kdc PE=3 SV=1 2 540 1.0E-72
sp|Q742Q2|KDC_MYCPA Alpha-keto-acid decarboxylase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=kdc PE=3 SV=1 3 545 2.0E-72
sp|Q6FJA3|PDC1_CANGA Pyruvate decarboxylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDC1 PE=3 SV=1 1 558 2.0E-72
sp|P33149|PDC1_KLUMA Pyruvate decarboxylase OS=Kluyveromyces marxianus GN=PDC1 PE=3 SV=1 1 558 1.0E-71
sp|P9WG37|KDC_MYCTU Alpha-keto-acid decarboxylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdc PE=1 SV=1 4 544 3.0E-71
sp|A5U0P1|KDC_MYCTA Alpha-keto-acid decarboxylase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=kdc PE=3 SV=1 4 544 3.0E-71
sp|A1KGY5|KDC_MYCBP Alpha-keto-acid decarboxylase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=kdc PE=3 SV=1 4 544 3.0E-71
sp|Q7U140|KDC_MYCBO Alpha-keto-acid decarboxylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kdc PE=3 SV=1 4 544 3.0E-71
sp|P9WG36|KDC_MYCTO Alpha-keto-acid decarboxylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdc PE=3 SV=1 4 544 1.0E-70
sp|P16467|PDC5_YEAST Pyruvate decarboxylase isozyme 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDC5 PE=1 SV=4 1 558 3.0E-69
sp|P83779|PDC1_CANAL Pyruvate decarboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PDC11 PE=1 SV=2 1 558 5.0E-69
sp|P06169|PDC1_YEAST Pyruvate decarboxylase isozyme 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDC1 PE=1 SV=7 1 558 3.0E-68
sp|P34734|PDC_HANUV Pyruvate decarboxylase OS=Hanseniaspora uvarum GN=PDC PE=3 SV=1 1 558 4.0E-68
sp|Q2UKV4|PDC_ASPOR Pyruvate decarboxylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdcA PE=3 SV=1 6 544 2.0E-67
sp|O42873|PDC4_SCHPO Putative pyruvate decarboxylase C3G9.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3G9.11c PE=3 SV=1 6 557 3.0E-65
sp|A0PL16|KDC_MYCUA Alpha-keto-acid decarboxylase OS=Mycobacterium ulcerans (strain Agy99) GN=kdc PE=3 SV=1 4 540 3.0E-65
sp|Q09737|PDC1_SCHPO Putative pyruvate decarboxylase C13A11.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13A11.06 PE=3 SV=2 6 557 6.0E-64
sp|Q4WXX9|PDC_ASPFU Pyruvate decarboxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pdcA PE=3 SV=1 6 500 2.0E-63
sp|P87208|PDC_EMENI Pyruvate decarboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pdcA PE=3 SV=3 6 516 1.0E-62
sp|Q0CNV1|PDC_ASPTN Pyruvate decarboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pdcA PE=3 SV=1 6 556 2.0E-60
sp|Q07471|THI3_YEAST Thiamine metabolism regulatory protein THI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI3 PE=1 SV=1 6 545 2.0E-54
sp|P51844|PDC_ASPPA Pyruvate decarboxylase OS=Aspergillus parasiticus GN=pdcA PE=3 SV=1 3 545 6.0E-54
sp|Q05327|PDC3_MAIZE Pyruvate decarboxylase 3 (Fragment) OS=Zea mays GN=PDC3 PE=2 SV=1 370 557 3.0E-50
sp|A0R480|KDC_MYCS2 Alpha-keto-acid decarboxylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=kdc PE=3 SV=1 4 289 5.0E-42
sp|Q06408|ARO10_YEAST Transaminated amino acid decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO10 PE=1 SV=1 2 544 9.0E-42
sp|P51852|DCIP_AZOBR Indole-3-pyruvate decarboxylase OS=Azospirillum brasilense GN=ipdC PE=1 SV=1 10 535 2.0E-32
sp|Q57725|ILVB_METJA Probable acetolactate synthase large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ilvB PE=3 SV=1 18 536 2.0E-31
sp|P96591|YDAP_BACSU Putative thiamine pyrophosphate-containing protein YdaP OS=Bacillus subtilis (strain 168) GN=ydaP PE=2 SV=1 1 549 3.0E-31
sp|Q9RQ65|ILVI_BUCSC Acetolactate synthase large subunit OS=Buchnera aphidicola subsp. Schlechtendalia chinensis GN=ilvI PE=3 SV=1 1 539 1.0E-30
sp|O85293|ILVI_BUCAP Acetolactate synthase large subunit OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ilvI PE=3 SV=1 1 540 4.0E-27
sp|Q89AP7|ILVI_BUCBP Acetolactate synthase large subunit OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ilvI PE=3 SV=1 1 494 1.0E-26
sp|P27868|ILVB_ARTPT Acetolactate synthase (Fragment) OS=Arthrospira platensis GN=ilvY PE=3 SV=1 10 549 3.0E-26
sp|P45261|ILVI_HAEIN Acetolactate synthase large subunit OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ilvI PE=3 SV=1 1 539 2.0E-25
sp|P0A623|ILVB_MYCBO Acetolactate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ilvB PE=3 SV=1 14 479 1.0E-24
sp|P9WG41|ILVB1_MYCTU Acetolactate synthase large subunit IlvB1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvB1 PE=1 SV=1 14 479 1.0E-24
sp|P9WG40|ILVB1_MYCTO Acetolactate synthase large subunit IlvB1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ilvB1 PE=3 SV=1 14 479 1.0E-24
sp|O33112|ILVB_MYCLE Acetolactate synthase OS=Mycobacterium leprae (strain TN) GN=ilvB PE=3 SV=1 14 481 1.0E-24
sp|P57321|ILVI_BUCAI Acetolactate synthase large subunit OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ilvI PE=3 SV=1 1 539 2.0E-23
sp|O78518|ILVB_GUITH Acetolactate synthase large subunit OS=Guillardia theta GN=ilvB PE=3 SV=1 5 548 5.0E-23
sp|Q59498|ILVB_MYCAV Acetolactate synthase OS=Mycobacterium avium GN=ilvB PE=3 SV=1 14 480 6.0E-23
sp|O08353|ILVB_METAO Probable acetolactate synthase large subunit OS=Methanococcus aeolicus GN=ilvB PE=3 SV=1 23 536 6.0E-23
sp|P00892|ILVG_ECOLI Acetolactate synthase isozyme 2 large subunit OS=Escherichia coli (strain K12) GN=ilvG PE=1 SV=3 48 537 2.0E-22
sp|P14874|ILVB2_BRANA Acetolactate synthase 2, chloroplastic OS=Brassica napus PE=3 SV=1 8 548 2.0E-22
sp|P42463|ILVB_CORGL Acetolactate synthase large subunit OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ilvB PE=3 SV=1 23 538 1.0E-21
sp|Q41768|ILVB1_MAIZE Acetolactate synthase 1, chloroplastic OS=Zea mays GN=ALS1 PE=3 SV=1 8 548 2.0E-21
sp|P40811|ILVI_SALTY Acetolactate synthase isozyme 3 large subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ilvI PE=3 SV=3 1 538 3.0E-21
sp|P00893|ILVI_ECOLI Acetolactate synthase isozyme 3 large subunit OS=Escherichia coli (strain K12) GN=ilvI PE=1 SV=2 1 538 9.0E-21
sp|Q1XDF6|ILVB_PYRYE Acetolactate synthase large subunit OS=Pyropia yezoensis GN=ilvB PE=3 SV=1 1 548 9.0E-21
sp|P69684|ILVB_PORUM Acetolactate synthase large subunit OS=Porphyra umbilicalis GN=ilvB PE=3 SV=1 1 548 1.0E-20
sp|P69683|ILVB_PORPU Acetolactate synthase large subunit OS=Porphyra purpurea GN=ilvB PE=3 SV=1 1 548 1.0E-20
sp|O06335|ILVB2_MYCTU Putative acetolactate synthase large subunit IlvB2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvB2 PE=2 SV=1 4 538 1.0E-20
sp|P09342|ILVB1_TOBAC Acetolactate synthase 1, chloroplastic OS=Nicotiana tabacum GN=ALS SURA PE=1 SV=1 8 548 2.0E-20
sp|P37251|ILVB_BACSU Acetolactate synthase large subunit OS=Bacillus subtilis (strain 168) GN=ilvB PE=1 SV=4 9 481 2.0E-20
sp|Q84H44|XSC_CASDE Sulfoacetaldehyde acetyltransferase OS=Castellaniella defragrans GN=xsc PE=1 SV=3 3 481 3.0E-20
sp|P09114|ILVB2_TOBAC Acetolactate synthase 2, chloroplastic OS=Nicotiana tabacum GN=ALS SURB PE=1 SV=1 8 548 7.0E-20
sp|Q41769|ILVB2_MAIZE Acetolactate synthase 2, chloroplastic OS=Zea mays GN=ALS2 PE=3 SV=1 8 498 2.0E-19
sp|P27818|ILVB1_BRANA Acetolactate synthase 1, chloroplastic OS=Brassica napus PE=3 SV=1 8 533 6.0E-19
sp|P27819|ILVB3_BRANA Acetolactate synthase 3, chloroplastic OS=Brassica napus PE=3 SV=1 8 533 6.0E-19
sp|P17597|ILVB_ARATH Acetolactate synthase, chloroplastic OS=Arabidopsis thaliana GN=ALS PE=1 SV=1 8 533 1.0E-18
sp|D5AKX8|XSC_RHOCB Sulfoacetaldehyde acetyltransferase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=xsc PE=2 SV=1 48 538 2.0E-18
sp|Q6K2E8|ILVB1_ORYSJ Acetolactate synthase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=ALS1 PE=2 SV=1 8 548 2.0E-18
sp|Q05326|PDC2_MAIZE Pyruvate decarboxylase 2 (Fragment) OS=Zea mays GN=PDC2 PE=2 SV=1 459 557 3.0E-18
sp|P27696|ILVB_KLEPN Acetolactate synthase, catabolic OS=Klebsiella pneumoniae GN=budB PE=1 SV=1 8 539 5.0E-18
sp|P08142|ILVB_ECOLI Acetolactate synthase isozyme 1 large subunit OS=Escherichia coli (strain K12) GN=ilvB PE=1 SV=1 4 548 8.0E-18
sp|Q9LCV9|CEAS_STRCL N(2)-(2-carboxyethyl)arginine synthase OS=Streptomyces clavuligerus GN=ceaS PE=1 SV=1 32 465 1.0E-17
sp|Q84H41|XSC_ALCXX Sulfoacetaldehyde acetyltransferase OS=Alcaligenes xylosoxydans xylosoxydans GN=xsc PE=1 SV=3 50 481 2.0E-17
sp|A0R480|KDC_MYCS2 Alpha-keto-acid decarboxylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=kdc PE=3 SV=1 363 557 4.0E-17
sp|Q02137|ILVB_LACLA Acetolactate synthase large subunit OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ilvB PE=3 SV=2 9 548 4.0E-17
sp|Q7U5G1|ILVB_SYNPX Acetolactate synthase large subunit OS=Synechococcus sp. (strain WH8102) GN=ilvB PE=3 SV=1 10 548 5.0E-17
sp|P9WG39|ILVG_MYCTU Acetolactate synthase large subunit IlvG OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvG PE=1 SV=1 7 492 8.0E-17
sp|P9WG38|ILVG_MYCTO Acetolactate synthase large subunit IlvG OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ilvG PE=3 SV=1 7 492 8.0E-17
sp|P66947|ILVG_MYCBO Probable acetolactate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ilvG PE=3 SV=1 7 492 8.0E-17
sp|Q5KPJ5|ILVB_CRYNJ Acetolactate synthase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ILV2 PE=3 SV=1 7 538 4.0E-16
sp|Q04524|ILVB_RAOTE Acetolactate synthase, catabolic OS=Raoultella terrigena GN=budB PE=3 SV=1 8 539 5.0E-16
sp|A7ZAH8|IOLD_BACMF 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=iolD PE=3 SV=1 203 558 7.0E-16
sp|P42415|IOLD_BACSU 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus subtilis (strain 168) GN=iolD PE=1 SV=2 50 558 7.0E-16
sp|Q6SSJ3|ILVB_CRYNH Acetolactate synthase, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=ILV2 PE=3 SV=1 7 538 8.0E-16
sp|A5YBJ6|IOLD_LACCA 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Lactobacillus casei GN=iolD PE=3 SV=2 161 468 1.0E-15
sp|P0CH62|CHDH_AZOSP Cyclohexane-1,2-dione hydrolase OS=Azoarcus sp. PE=1 SV=1 161 537 1.0E-15
sp|P07342|ILVB_YEAST Acetolactate synthase catalytic subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV2 PE=1 SV=1 4 537 1.0E-15
sp|Q9HUR2|MDLC_PSEAE Benzoylformate decarboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mdlC PE=3 SV=1 58 533 2.0E-15
sp|Q92UW6|XSC_RHIME Probable sulfoacetaldehyde acetyltransferase OS=Rhizobium meliloti (strain 1021) GN=xsc PE=3 SV=1 48 463 2.0E-15
sp|Q9HUI8|ARUI_PSEAE Probable 2-ketoarginine decarboxylase AruI OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruI PE=1 SV=1 3 465 2.0E-15
sp|P36620|ILVB_SCHPO Acetolactate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ilv1 PE=3 SV=2 5 539 2.0E-15
sp|Q9QXE0|HACL1_MOUSE 2-hydroxyacyl-CoA lyase 1 OS=Mus musculus GN=Hacl1 PE=1 SV=2 46 536 3.0E-15
sp|Q7XKQ8|ILVB2_ORYSJ Probable acetolactate synthase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=ALS2 PE=2 SV=2 8 487 3.0E-15
sp|P0AEP7|GCL_ECOLI Glyoxylate carboligase OS=Escherichia coli (strain K12) GN=gcl PE=1 SV=2 1 534 3.0E-15
sp|P0AEP8|GCL_ECO57 Glyoxylate carboligase OS=Escherichia coli O157:H7 GN=gcl PE=3 SV=2 1 534 3.0E-15
sp|A4IPB6|IOLD_GEOTN 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=iolD PE=3 SV=1 19 468 5.0E-15
sp|P20906|MDLC_PSEPU Benzoylformate decarboxylase OS=Pseudomonas putida GN=mdlC PE=1 SV=2 12 468 9.0E-15
sp|Q8CHM7|HACL1_RAT 2-hydroxyacyl-CoA lyase 1 OS=Rattus norvegicus GN=Hacl1 PE=1 SV=1 46 536 2.0E-14
sp|Q9LF46|HACL_ARATH 2-hydroxyacyl-CoA lyase OS=Arabidopsis thaliana GN=HACL PE=1 SV=1 9 467 6.0E-13
sp|Q5WKY8|IOLD_BACSK 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus clausii (strain KSM-K16) GN=iolD PE=3 SV=1 50 535 7.0E-13
sp|Q54DA9|HACL1_DICDI Probable 2-hydroxyacyl-CoA lyase 1 OS=Dictyostelium discoideum GN=hacl1 PE=3 SV=1 47 467 1.0E-12
sp|Q9UJ83|HACL1_HUMAN 2-hydroxyacyl-CoA lyase 1 OS=Homo sapiens GN=HACL1 PE=1 SV=2 46 536 5.0E-12
sp|Q93PS3|XSC_DESTI Sulfoacetaldehyde acetyltransferase OS=Desulfonispora thiosulfatigenes GN=xsc PE=1 SV=1 3 536 8.0E-12
sp|Q92EQ4|IOLD_LISIN 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=iolD PE=3 SV=1 37 547 2.0E-11
sp|P37063|POXB_LACPL Pyruvate oxidase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pox5 PE=1 SV=3 18 468 5.0E-11
sp|P07003|POXB_ECOLI Pyruvate dehydrogenase [ubiquinone] OS=Escherichia coli (strain K12) GN=poxB PE=1 SV=1 5 541 3.0E-10
sp|Q0JMH0|HACL_ORYSJ 2-hydroxyacyl-CoA lyase OS=Oryza sativa subsp. japonica GN=Os01g0505400 PE=3 SV=3 68 467 1.0E-07
sp|Q4V1F5|IOLD2_BACCZ 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase 2 OS=Bacillus cereus (strain ZK / E33L) GN=iolD2 PE=3 SV=1 50 292 1.0E-07
sp|P40149|OXC_OXAFO Oxalyl-CoA decarboxylase OS=Oxalobacter formigenes GN=oxc PE=1 SV=1 68 256 2.0E-06
sp|P10343|YI42_PSEAY Uncharacterized 42.6 kDa protein in isoamylase 3'region OS=Pseudomonas amyloderamosa PE=4 SV=1 1 287 3.0E-06
sp|Q9Y7M1|YGK4_SCHPO Putative 2-hydroxyacyl-CoA lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.04 PE=3 SV=1 81 467 4.0E-06
sp|Q54970|POXB_STRPN Pyruvate oxidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=spxB PE=3 SV=2 14 287 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000287 magnesium ion binding Yes
GO:0003824 catalytic activity Yes
GO:0030976 thiamine pyrophosphate binding Yes
GO:0050662 coenzyme binding No
GO:0046872 metal ion binding No
GO:1901681 sulfur compound binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0019842 vitamin binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6050
MASFTVGDFLAERLAQIGVRNHFLVPGDYNLLLLDKLEAHPDLAGVGCTNELNCSLAAEGYARATGVGACVVTFG
VGAFAAFNGIGSAYAENLPVILISGAPNTNDIGRHVLHHTLGERVFAYQLDMAKHITCCAVAISRAVDAPDLIDR
AIRTALLERKPAYIEIPTNLSGGVCARPGPVNALVEPVPSDWRGLAAAVGSVAEYLGTKQKPVLLAGPKVQRAGA
AKALLRLAEAIGCAVVLQPAAKGCFPEDHPQFAGIFWGQVSTLAADTIVNWADVLLCAGTVFTDYSTVGWTALPG
VPQIIANVDSVTDVRSHYSRVHLGDFLTGLAEAVSRNDTTMVEYNRLRLDPSFGQIACEQDKLTRKEITRQVQAL
LTPETTVFVETGDSWFNGIQLNLPRGAEFEIEMQWGHIGWTVPASFGYALAKPTKRTIVMVGDGAFQMTAQEVSQ
MVRHCVPIILLLMNNGGYTIEVEIHDGFYNRIQNWNYTVLVEAFNSADGHGRALGLVARTAGEFSEAIKTALVHT
DGPTLIECKIDQDDCSRELITWGHFVAAANARQT*
Coding >Hirsu2|6050
ATGGCTTCTTTTACCGTGGGCGACTTCCTTGCCGAGAGGCTCGCTCAGATTGGTGTTCGAAATCATTTCCTAGTA
CCTGGCGATTATAACTTGCTCCTTCTCGATAAGCTCGAGGCGCATCCAGACTTAGCCGGAGTCGGCTGCACCAAC
GAGCTTAACTGTTCGCTCGCGGCCGAAGGATACGCCCGGGCGACTGGCGTCGGCGCGTGTGTCGTCACCTTTGGC
GTGGGCGCTTTCGCAGCGTTCAACGGCATCGGCAGCGCATATGCCGAGAACTTGCCCGTCATCTTGATCAGCGGA
GCGCCTAACACTAATGATATCGGCCGTCATGTCCTGCACCACACACTCGGCGAGCGTGTCTTCGCTTACCAGCTA
GACATGGCCAAGCATATCACATGTTGTGCGGTAGCGATTTCTAGAGCCGTCGACGCCCCGGATTTGATCGATCGC
GCCATACGAACTGCGCTCTTAGAGCGAAAGCCGGCCTATATAGAGATACCGACCAATCTCTCGGGCGGAGTCTGT
GCCCGGCCCGGACCTGTCAACGCTCTTGTCGAGCCCGTCCCAAGCGATTGGCGGGGGCTTGCGGCGGCTGTCGGC
AGCGTTGCCGAGTATCTCGGCACGAAACAGAAGCCTGTCCTTCTCGCTGGTCCCAAAGTGCAGAGAGCCGGCGCA
GCCAAGGCCCTTCTGCGTCTGGCTGAAGCCATCGGGTGCGCCGTCGTGCTTCAGCCAGCGGCCAAGGGCTGTTTT
CCTGAGGATCATCCACAGTTCGCCGGAATCTTCTGGGGCCAAGTCAGCACGCTCGCCGCCGACACAATCGTCAAC
TGGGCCGACGTGCTTCTCTGCGCAGGCACCGTCTTTACGGACTACAGCACGGTCGGCTGGACGGCCTTGCCCGGC
GTGCCGCAGATCATCGCCAATGTGGACAGCGTAACTGACGTGCGCTCTCATTACAGCCGTGTCCACCTGGGCGAC
TTTCTCACCGGACTGGCCGAGGCCGTCAGCCGCAACGACACCACCATGGTCGAGTACAATCGACTGCGCCTCGAC
CCATCGTTCGGGCAAATCGCCTGCGAACAAGACAAATTAACACGGAAGGAGATCACTCGACAGGTCCAAGCGCTA
CTGACCCCAGAAACGACCGTCTTCGTGGAAACGGGCGACTCATGGTTCAACGGAATTCAGCTAAACCTTCCACGC
GGAGCAGAGTTCGAAATCGAGATGCAGTGGGGCCATATTGGATGGACGGTTCCCGCTTCGTTCGGTTATGCACTT
GCAAAGCCCACGAAGAGGACCATCGTCATGGTAGGGGACGGCGCATTCCAGATGACTGCACAAGAGGTCTCGCAG
ATGGTACGGCACTGCGTGCCCATCATTTTGCTGTTAATGAACAATGGAGGCTACACGATCGAGGTCGAGATTCAC
GATGGGTTTTACAACCGCATCCAGAACTGGAACTACACGGTTCTCGTCGAGGCATTTAATTCGGCGGATGGCCAT
GGGCGTGCTCTCGGCCTGGTGGCCCGTACAGCCGGCGAATTTTCCGAGGCCATCAAGACCGCGCTGGTGCATACG
GATGGTCCAACGCTCATCGAGTGCAAAATCGATCAGGATGATTGCAGCAGGGAACTGATCACTTGGGGCCATTTT
GTAGCGGCTGCCAACGCCCGTCAGACATAA
Transcript >Hirsu2|6050
ATGGCTTCTTTTACCGTGGGCGACTTCCTTGCCGAGAGGCTCGCTCAGATTGGTGTTCGAAATCATTTCCTAGTA
CCTGGCGATTATAACTTGCTCCTTCTCGATAAGCTCGAGGCGCATCCAGACTTAGCCGGAGTCGGCTGCACCAAC
GAGCTTAACTGTTCGCTCGCGGCCGAAGGATACGCCCGGGCGACTGGCGTCGGCGCGTGTGTCGTCACCTTTGGC
GTGGGCGCTTTCGCAGCGTTCAACGGCATCGGCAGCGCATATGCCGAGAACTTGCCCGTCATCTTGATCAGCGGA
GCGCCTAACACTAATGATATCGGCCGTCATGTCCTGCACCACACACTCGGCGAGCGTGTCTTCGCTTACCAGCTA
GACATGGCCAAGCATATCACATGTTGTGCGGTAGCGATTTCTAGAGCCGTCGACGCCCCGGATTTGATCGATCGC
GCCATACGAACTGCGCTCTTAGAGCGAAAGCCGGCCTATATAGAGATACCGACCAATCTCTCGGGCGGAGTCTGT
GCCCGGCCCGGACCTGTCAACGCTCTTGTCGAGCCCGTCCCAAGCGATTGGCGGGGGCTTGCGGCGGCTGTCGGC
AGCGTTGCCGAGTATCTCGGCACGAAACAGAAGCCTGTCCTTCTCGCTGGTCCCAAAGTGCAGAGAGCCGGCGCA
GCCAAGGCCCTTCTGCGTCTGGCTGAAGCCATCGGGTGCGCCGTCGTGCTTCAGCCAGCGGCCAAGGGCTGTTTT
CCTGAGGATCATCCACAGTTCGCCGGAATCTTCTGGGGCCAAGTCAGCACGCTCGCCGCCGACACAATCGTCAAC
TGGGCCGACGTGCTTCTCTGCGCAGGCACCGTCTTTACGGACTACAGCACGGTCGGCTGGACGGCCTTGCCCGGC
GTGCCGCAGATCATCGCCAATGTGGACAGCGTAACTGACGTGCGCTCTCATTACAGCCGTGTCCACCTGGGCGAC
TTTCTCACCGGACTGGCCGAGGCCGTCAGCCGCAACGACACCACCATGGTCGAGTACAATCGACTGCGCCTCGAC
CCATCGTTCGGGCAAATCGCCTGCGAACAAGACAAATTAACACGGAAGGAGATCACTCGACAGGTCCAAGCGCTA
CTGACCCCAGAAACGACCGTCTTCGTGGAAACGGGCGACTCATGGTTCAACGGAATTCAGCTAAACCTTCCACGC
GGAGCAGAGTTCGAAATCGAGATGCAGTGGGGCCATATTGGATGGACGGTTCCCGCTTCGTTCGGTTATGCACTT
GCAAAGCCCACGAAGAGGACCATCGTCATGGTAGGGGACGGCGCATTCCAGATGACTGCACAAGAGGTCTCGCAG
ATGGTACGGCACTGCGTGCCCATCATTTTGCTGTTAATGAACAATGGAGGCTACACGATCGAGGTCGAGATTCAC
GATGGGTTTTACAACCGCATCCAGAACTGGAACTACACGGTTCTCGTCGAGGCATTTAATTCGGCGGATGGCCAT
GGGCGTGCTCTCGGCCTGGTGGCCCGTACAGCCGGCGAATTTTCCGAGGCCATCAAGACCGCGCTGGTGCATACG
GATGGTCCAACGCTCATCGAGTGCAAAATCGATCAGGATGATTGCAGCAGGGAACTGATCACTTGGGGCCATTTT
GTAGCGGCTGCCAACGCCCGTCAGACATAA
Gene >Hirsu2|6050
ATGGCTTCTTTTACCGTGGGCGACTTCCTTGCCGAGAGGCTCGCTCAGATTGGTGTTCGAAATCATTTCCTAGTA
CCTGGCGATTATAACTTGCTCCTTCTCGATAAGCTCGAGGCGCATCCAGACTTAGCCGGAGTCGGCTGCACCAAC
GAGCTTAACTGTTCGCTCGCGGCCGAAGGATACGCCCGGGCGACTGGCGTCGGCGCGTGTGTCGTCACCTTTGGC
GTGGGCGCTTTCGCAGCGTTCAACGGCATCGGCAGCGCATATGCCGAGAACTTGCCCGTCATCTTGATCAGCGGA
GCGCCTAACACTAATGATATCGGCCGTCATGTCCTGCACCACACACTCGGCGAGCGTGTCTTCGCTTACCAGCTA
GACATGGCCAAGCATATCACATGTTGTGCGGTAGCGATTTCTAGAGCCGTCGACGCCCCGGATTTGATCGATCGC
GCCATACGAACTGCGCTCTTAGAGCGAAAGCCGGCCTATATAGAGATACCGACCAATCTCTCGGGCGGAGTCTGT
GCCCGGCCCGGACCTGTCAACGCTCTTGTCGAGCCCGTCCCAAGCGATTGGCGGGGGCTTGCGGCGGCTGTCGGC
AGCGTTGCCGAGTATCTCGGCACGAAACAGAAGCCTGTCCTTCTCGCTGGTCCCAAAGTGCAGAGAGCCGGCGCA
GCCAAGGCCCTTCTGCGTCTGGCTGAAGCCATCGGGTGCGCCGTCGTGCTTCAGCCAGCGGCCAAGGGCTGTTTT
CCTGAGGATCATCCACAGTTCGCCGGAATCTTCTGGGGCCAAGTCAGCACGCTCGCCGCCGACACAATCGTCAAC
TGGGCCGACGTGCTTCTCTGCGCAGGCACCGTCTTTACGGACTACAGCACGGTCGGCTGGACGGCCTTGCCCGGC
GTGCCGCAGATCATCGCCAATGTGGACAGCGTAACTGACGTGCGCTCTCATTACAGCCGTGTCCACCTGGGCGAC
TTTCTCACCGGACTGGCCGAGGCCGTCAGCCGCAACGACACCACCATGGTCGAGTACAATCGACTGCGCCTCGAC
CCATCGTTCGGGCAAATCGCCTGCGAACAAGACAAATTAACACGGAAGGAGATCACTCGACAGGTCCAAGCGCTA
CTGACCCCAGAAACGACCGTCTTCGTGGAAACGGGCGACTCATGGTTCAACGGAATTCAGCTAAACCTTCCACGC
GGAGCAGAGTTCGAAATCGAGATGCAGTGGGGCCATATTGGATGGACGGTTCCCGCTTCGTTCGGTTATGCACTT
GCAAAGCCCACGAAGAGGACCATCGTCATGGTAGGGGACGGCGCATTCCAGATGACTGCACAAGAGGTCTCGCAG
ATGGTACGGCACTGCGTGCCCATCATTTTGCTGTTAATGAACAATGGAGGCTACACGATCGAGGTCGAGATTCAC
GATGGGTTTTACAACCGCATCCAGAACTGGAACTACACGGTTCTCGTCGAGGCATTTAATTCGGCGGATGGCCAT
GGGCGTGCTCTCGGCCTGGTGGCCCGTACAGCCGGCGAATTTTCCGAGGCCATCAAGACCGCGCTGGTGCATACG
GATGGTCCAACGCTCATCGAGTGCAAAATCGATCAGGATGATTGCAGCAGGGAACTGATCACTTGGGGCCATTTT
GTAGCGGCTGCCAACGCCCGTCAGACATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail