Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|605
Gene name
LocationContig_112:22971..29323
Strand-
Gene length (bp)6352
Transcript length (bp)6204
Coding sequence length (bp)6204
Protein length (aa) 2068

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07728 AAA_5 AAA domain (dynein-related subfamily) 1.8E-22 304 427
PF07728 AAA_5 AAA domain (dynein-related subfamily) 5.9E-06 636 682
PF07728 AAA_5 AAA domain (dynein-related subfamily) 2.3E-07 804 892
PF07728 AAA_5 AAA domain (dynein-related subfamily) 1.3E-21 1083 1218
PF07728 AAA_5 AAA domain (dynein-related subfamily) 5.3E-08 1374 1419
PF07728 AAA_5 AAA domain (dynein-related subfamily) 4.5E-15 1470 1573
PF07728 AAA_5 AAA domain (dynein-related subfamily) 2.0E-18 1755 1893
PF17867 AAA_lid_7 Midasin AAA lid domain 3.0E-22 454 569
PF17867 AAA_lid_7 Midasin AAA lid domain 3.1E-11 1230 1323
PF17867 AAA_lid_7 Midasin AAA lid domain 1.0E-12 1905 2002
PF17865 AAA_lid_5 Midasin AAA lid domain 4.1E-31 906 1010
PF07726 AAA_3 ATPase family associated with various cellular activities (AAA) 4.4E-05 1083 1219
PF07726 AAA_3 ATPase family associated with various cellular activities (AAA) 3.8E-10 1755 1894
PF12775 AAA_7 P-loop containing dynein motor region 2.8E-07 280 345
PF00004 AAA ATPase family associated with various cellular activities (AAA) 3.2E-05 1755 1799

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12019|MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDN1 PE=1 SV=1 2 2004 0.0E+00
sp|O94248|MDN1_SCHPO Midasin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdn1 PE=1 SV=1 260 2062 0.0E+00
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 281 2003 0.0E+00
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 296 2000 0.0E+00
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 280 2059 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12019|MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDN1 PE=1 SV=1 2 2004 0.0E+00
sp|O94248|MDN1_SCHPO Midasin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdn1 PE=1 SV=1 260 2062 0.0E+00
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 281 2003 0.0E+00
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 296 2000 0.0E+00
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 280 2059 0.0E+00
sp|O94248|MDN1_SCHPO Midasin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdn1 PE=1 SV=1 219 1578 5.0E-96
sp|Q12019|MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDN1 PE=1 SV=1 790 1581 7.0E-71
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 1068 1578 4.0E-49
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 278 921 4.0E-48
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 286 937 6.0E-32
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 259 897 1.0E-27
sp|Q12019|MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDN1 PE=1 SV=1 256 897 3.0E-27
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 286 919 1.0E-24
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 282 686 2.0E-23
sp|Q4L6B6|Y1500_STAHJ Uncharacterized protein SH1500 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1500 PE=3 SV=1 1066 1322 1.0E-19
sp|Q99U78|Y1409_STAAM Uncharacterized protein SAV1409 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1409 PE=3 SV=1 1083 1322 5.0E-19
sp|Q6G9F2|Y1352_STAAS Uncharacterized protein SAS1352 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1352 PE=3 SV=1 1083 1322 5.0E-19
sp|Q2G2J8|Y1413_STAA8 Uncharacterized protein SAOUHSC_01413 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_01413 PE=3 SV=1 1083 1322 5.0E-19
sp|Q7A0W8|Y1299_STAAW Uncharacterized protein MW1299 OS=Staphylococcus aureus (strain MW2) GN=MW1299 PE=3 SV=1 1083 1322 5.0E-19
sp|Q6GGZ9|Y1421_STAAR Uncharacterized protein SAR1421 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1421 PE=3 SV=1 1083 1322 5.0E-19
sp|Q7A5N7|Y1241_STAAN Uncharacterized protein SA1241 OS=Staphylococcus aureus (strain N315) GN=SA1241 PE=3 SV=1 1083 1322 5.0E-19
sp|Q8CP85|Y1092_STAES Uncharacterized protein SE_1092 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1092 PE=3 SV=1 1083 1322 5.0E-19
sp|Q2FH29|Y1302_STAA3 Uncharacterized protein SAUSA300_1302 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1302 PE=3 SV=1 1083 1322 5.0E-19
sp|Q5HG10|Y1445_STAAC Uncharacterized protein SACOL1445 OS=Staphylococcus aureus (strain COL) GN=SACOL1445 PE=3 SV=1 1083 1322 5.0E-19
sp|Q2YY09|Y1265_STAAB Uncharacterized protein SAB1265c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1265c PE=3 SV=1 1083 1322 6.0E-19
sp|Q5HPD3|Y979_STAEQ Uncharacterized protein SERP0979 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0979 PE=3 SV=1 1083 1322 2.0E-18
sp|Q49XL1|Y1341_STAS1 Uncharacterized protein SSP1341 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1341 PE=3 SV=2 1062 1322 4.0E-18
sp|Q51481|NIRQ_PSEAE Denitrification regulatory protein NirQ OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nirQ PE=2 SV=1 1081 1262 1.0E-15
sp|O31850|YOJN_BACSU Uncharacterized protein YojN OS=Bacillus subtilis (strain 168) GN=yojN PE=3 SV=1 1083 1323 2.0E-15
sp|Q02441|NIRQ_PSEST Denitrification regulatory protein NirQ OS=Pseudomonas stutzeri GN=nirQ PE=2 SV=1 1081 1271 2.0E-15
sp|Q7A5N7|Y1241_STAAN Uncharacterized protein SA1241 OS=Staphylococcus aureus (strain N315) GN=SA1241 PE=3 SV=1 1734 1907 1.0E-13
sp|Q2FH29|Y1302_STAA3 Uncharacterized protein SAUSA300_1302 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1302 PE=3 SV=1 1734 1907 1.0E-13
sp|Q7A0W8|Y1299_STAAW Uncharacterized protein MW1299 OS=Staphylococcus aureus (strain MW2) GN=MW1299 PE=3 SV=1 1734 1907 1.0E-13
sp|Q2YY09|Y1265_STAAB Uncharacterized protein SAB1265c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1265c PE=3 SV=1 1734 1907 1.0E-13
sp|Q6G9F2|Y1352_STAAS Uncharacterized protein SAS1352 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1352 PE=3 SV=1 1734 1907 1.0E-13
sp|Q99U78|Y1409_STAAM Uncharacterized protein SAV1409 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1409 PE=3 SV=1 1734 1907 1.0E-13
sp|Q5HG10|Y1445_STAAC Uncharacterized protein SACOL1445 OS=Staphylococcus aureus (strain COL) GN=SACOL1445 PE=3 SV=1 1734 1907 1.0E-13
sp|Q2G2J8|Y1413_STAA8 Uncharacterized protein SAOUHSC_01413 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_01413 PE=3 SV=1 1734 1907 1.0E-13
sp|Q6GGZ9|Y1421_STAAR Uncharacterized protein SAR1421 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1421 PE=3 SV=1 1734 1907 1.0E-13
sp|Q5HPD3|Y979_STAEQ Uncharacterized protein SERP0979 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0979 PE=3 SV=1 1749 1909 3.0E-13
sp|Q51664|NORQ_PARDP Protein NorQ OS=Paracoccus denitrificans (strain Pd 1222) GN=norQ PE=3 SV=2 1081 1237 3.0E-13
sp|Q51858|CBBQ_HYDTE Protein CbbQ OS=Hydrogenophilus thermoluteolus GN=cbbQ PE=3 SV=1 1075 1253 4.0E-13
sp|Q49XL1|Y1341_STAS1 Uncharacterized protein SSP1341 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1341 PE=3 SV=2 1749 1899 4.0E-13
sp|Q8CP85|Y1092_STAES Uncharacterized protein SE_1092 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1092 PE=3 SV=1 1749 1909 5.0E-13
sp|Q4L6B6|Y1500_STAHJ Uncharacterized protein SH1500 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1500 PE=3 SV=1 1749 1907 2.0E-12
sp|O31850|YOJN_BACSU Uncharacterized protein YojN OS=Bacillus subtilis (strain 168) GN=yojN PE=3 SV=1 1748 1941 3.0E-10
sp|Q51664|NORQ_PARDP Protein NorQ OS=Paracoccus denitrificans (strain Pd 1222) GN=norQ PE=3 SV=2 1754 1899 4.0E-10
sp|Q51481|NIRQ_PSEAE Denitrification regulatory protein NirQ OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nirQ PE=2 SV=1 1747 1899 6.0E-10
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 1425 1578 1.0E-09
sp|Q12019|MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDN1 PE=1 SV=1 1801 1899 2.0E-09
sp|Q02441|NIRQ_PSEST Denitrification regulatory protein NirQ OS=Pseudomonas stutzeri GN=nirQ PE=2 SV=1 1747 1911 2.0E-09
sp|O31850|YOJN_BACSU Uncharacterized protein YojN OS=Bacillus subtilis (strain 168) GN=yojN PE=3 SV=1 304 510 3.0E-09
sp|Q51664|NORQ_PARDP Protein NorQ OS=Paracoccus denitrificans (strain Pd 1222) GN=norQ PE=3 SV=2 303 420 3.0E-09
sp|P29933|COBS_PSEDE Aerobic cobaltochelatase subunit CobS OS=Pseudomonas denitrificans GN=cobS PE=1 SV=1 1083 1327 3.0E-09
sp|Q51858|CBBQ_HYDTE Protein CbbQ OS=Hydrogenophilus thermoluteolus GN=cbbQ PE=3 SV=1 1754 1893 4.0E-09
sp|O94248|MDN1_SCHPO Midasin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdn1 PE=1 SV=1 1806 1875 5.0E-09
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 1803 1897 2.0E-07
sp|Q4L6B6|Y1500_STAHJ Uncharacterized protein SH1500 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1500 PE=3 SV=1 1366 1621 4.0E-07
sp|Q02441|NIRQ_PSEST Denitrification regulatory protein NirQ OS=Pseudomonas stutzeri GN=nirQ PE=2 SV=1 303 420 4.0E-07
sp|Q8CC88|VWA8_MOUSE von Willebrand factor A domain-containing protein 8 OS=Mus musculus GN=Vwa8 PE=1 SV=2 1142 1901 4.0E-07
sp|Q8CC88|VWA8_MOUSE von Willebrand factor A domain-containing protein 8 OS=Mus musculus GN=Vwa8 PE=1 SV=2 304 676 1.0E-06
sp|Q49XL1|Y1341_STAS1 Uncharacterized protein SSP1341 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1341 PE=3 SV=2 1372 1620 1.0E-06
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 1132 1223 2.0E-06
sp|Q51481|NIRQ_PSEAE Denitrification regulatory protein NirQ OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nirQ PE=2 SV=1 286 420 2.0E-06
sp|Q51858|CBBQ_HYDTE Protein CbbQ OS=Hydrogenophilus thermoluteolus GN=cbbQ PE=3 SV=1 303 417 2.0E-06
sp|Q8CP85|Y1092_STAES Uncharacterized protein SE_1092 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1092 PE=3 SV=1 1491 1651 3.0E-06
sp|P29933|COBS_PSEDE Aerobic cobaltochelatase subunit CobS OS=Pseudomonas denitrificans GN=cobS PE=1 SV=1 1739 1874 3.0E-06
sp|Q5HPD3|Y979_STAEQ Uncharacterized protein SERP0979 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0979 PE=3 SV=1 1491 1651 4.0E-06
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 1805 1875 4.0E-06
sp|Q99U78|Y1409_STAAM Uncharacterized protein SAV1409 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1409 PE=3 SV=1 791 952 5.0E-06
sp|Q2FH29|Y1302_STAA3 Uncharacterized protein SAUSA300_1302 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1302 PE=3 SV=1 791 952 5.0E-06
sp|Q7A5N7|Y1241_STAAN Uncharacterized protein SA1241 OS=Staphylococcus aureus (strain N315) GN=SA1241 PE=3 SV=1 791 952 5.0E-06
sp|Q7A0W8|Y1299_STAAW Uncharacterized protein MW1299 OS=Staphylococcus aureus (strain MW2) GN=MW1299 PE=3 SV=1 791 952 5.0E-06
sp|Q5HG10|Y1445_STAAC Uncharacterized protein SACOL1445 OS=Staphylococcus aureus (strain COL) GN=SACOL1445 PE=3 SV=1 791 952 5.0E-06
sp|Q6G9F2|Y1352_STAAS Uncharacterized protein SAS1352 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1352 PE=3 SV=1 791 952 5.0E-06
sp|Q6GGZ9|Y1421_STAAR Uncharacterized protein SAR1421 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1421 PE=3 SV=1 791 952 5.0E-06
sp|Q2G2J8|Y1413_STAA8 Uncharacterized protein SAOUHSC_01413 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_01413 PE=3 SV=1 791 952 5.0E-06
sp|A3KMH1|VWA8_HUMAN von Willebrand factor A domain-containing protein 8 OS=Homo sapiens GN=VWA8 PE=1 SV=2 1489 1901 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016887 ATPase activity Yes
GO:0005524 ATP binding Yes
GO:0032553 ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0032555 purine ribonucleotide binding No
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|605
MIDVSRQRRSLLEDATALDHLPPDLLEIIRHHSSTNLLDAVAQAALKPALTERVFAHFENVFPDICARWILDARS
ATQQTLAAAAFARVLPFAPYLSEFLKCSTQGPLPVNERPSSLHLPLSPVDEHSSSQLNVDDLLQVLLTTWRLLSF
DLRTFKPLVSPSYMQSLFRQESRAVRYVAIRIFCQLLDAADFKLEALVNEHCGQEDAIVANLDGAPIDLGFLSLH
EHARVQNVVTLREHVKRGQSGSSHEPVLHALTQYVVPYGNVVLPRPHGSLGDPSTLVMTSTTTRNLENLASMLRQ
ADPILLHGPSGVGKTALVHEFAQQLGTYANMVTLHLNEQTDAKMLVGLYSTNSKPGSFQWRPGVLTTAVKEGRWV
LIEDLDRAPTEVLSTLLPLVERRELLIPTRGERIRAAKSFRLFATVRTSRGMNGRESLPNLVGLRSWQSLHTHPL
VSSELQEVVLQTYPILRKFAPGILAVHERLSLLTGNPALMSRGRSVMDRQMSLRDLLKWCRRLRECLLAAGSTSG
DEPISETTRDWMFMEALDCFVGSCPDVELGKQFVHAIAEEMHMSRDRAEHFLSANIPHLEENDLVFSIGRAQLRK
MKAAARLQRSRRPFASTTHAKKLLEQIAVAVRLQEPVLLVGETGIGKTTVVQQLAESLGHKLIAVNLSQQSEVGD
LLGGFKPVNVRSLAVPLKEEFEDLFAATGISASKNQKYLEQIGKSFAKGQWSKLSKLWREAPKMFVKIIAELERM
QSQSRDDDAQPTKRRKTQSKLQSLTELRPRWDSFARNLDQFEVQISGGSGGFAFSFVEGNLVKAVRNGDWVLLDE
INLASPDTLESIADLLSGPDERPSILLAETGELEKVVAHPNFRIFGAMNPATDVGKRDLPIGIRSRFTELYVRSP
DADHKDLLTIVKAYLGSSSTKSDQAADDIARLYLNTKRMAEEKRLVDGANEVPHFSLRTLTRVLSYVNTIAPLYG
LRRALYEGFSMGFLTLLDRGSEDMLLPLIYHHLLDKHGNPQSLLSQPPKHPNDGRRYVKFQNQKRDRQYWLFQGD
QTPIERDDYIITPYVERNLLNIVRATSTRRFPILIQGPTSAGKTSMIEYLANFTGNKFVRINNHEHTDLQEYLGT
YVSGPDGKLRFQEGLLVQAMRQGHWIVLDELNLAPTDVLEALNRLLDDNRELLIPETQEVVRPHENFILFATQNP
PGLYGGRKVLSRAFRNRFLELHFDDIPEDELEYILQQRSRNTSPPDCRRIVTVYKELSRLRQTSRLFEQKDSFAT
LRDLFRWALRDADTREEIAAHGFMLLAERVRDEEERMAVKGIIEKVFKTEIKPEELYSADVATELRHLTRQPGGQ
DVVWTRAMRRLYVLVSRALRNNEPVLLVGETGCGKTTVCQLLAEALQKQLSIVNAHQNTETGDLIGSQRPVRNRG
AVIGALDADLTSVLGNFGLVVPSSTDEKLQAYRSLDESSISKIPQELEQRIAANETRTKALFEWSDGALVEAMRG
GHFFLLDEISLADDSVLERLNSVLEPQRTLLLAEKGIDNSFVVASDGFQFFATMNPGGDFGKKELSPALRNRFTE
IWVPPLSENHDIYEIVRSKLADGRKHLVDALVQFAVWFGPTFRPMATTPFSVREVLACVQFINTFETADPVESLV
HGASAIFIDSIGANPSAMLATDLNAIHQQRAECLKTLERLIGRDVSDIYGSRPELVVTDGSLTIGNFSVPRSATS
TTGTGFAFHAPTTRLNAMRVLRALQVHKPILLEGSPGVGKTSLVAALAQACGRPLTRINLSDQTDLMDLFGTDVP
VEGEEAGNFAWRDAPFLQAMQKGEWVLLDEMNLASQSVLEGLNACLDHRGEVYISELDQVFKRHPDFRLFAAQNP
HHQGGGRKGLPASFVNRFIVVYADIFKDEDLRLIASHNFPDLCPKITGLLIDFISQMDHQVVVEKSFGAQGGPWE
FNLRDVLRWLDLLSSSDPLLRTARVDDFLNIIVRQRFRTQKDREEVDKLFGRLAGWQPRTHSFYHDVNSRFSQVG
LALLHRNTICQPERLPSIDIVARLPELESLMEVLSRQTRFER*
Coding >Hirsu2|605
ATGATCGACGTCTCCCGGCAGAGGAGGTCGCTCCTGGAGGACGCGACTGCGCTCGATCATCTGCCGCCGGACTTG
CTGGAAATTATCCGGCATCATTCGTCGACGAACCTCCTGGACGCTGTCGCGCAGGCGGCTCTCAAGCCAGCACTT
ACAGAGCGCGTCTTCGCCCATTTCGAAAACGTCTTCCCCGACATTTGCGCGCGATGGATCCTCGACGCCCGGTCC
GCCACGCAGCAAACGTTGGCCGCCGCCGCCTTTGCCAGGGTTCTACCCTTTGCGCCCTATCTTTCAGAATTTCTC
AAGTGTTCGACTCAGGGGCCGCTGCCTGTGAATGAGAGGCCGTCGTCGCTACACCTGCCGCTGTCCCCGGTCGAC
GAACACTCGTCGTCTCAGCTGAATGTCGACGACCTGCTGCAGGTTCTACTCACGACATGGAGGTTGCTGAGCTTT
GACCTCCGCACATTCAAGCCTCTGGTTTCGCCGTCTTACATGCAGAGCTTGTTCCGACAGGAAAGCAGGGCTGTT
CGATATGTTGCAATTCGTATCTTCTGCCAGTTGCTTGATGCGGCCGACTTCAAGCTCGAGGCTCTCGTCAACGAG
CACTGTGGCCAGGAAGACGCCATCGTCGCCAACCTGGACGGAGCGCCCATAGACTTGGGCTTCTTGTCGCTGCAT
GAGCATGCCCGTGTCCAAAACGTCGTCACCTTGCGCGAACACGTGAAGCGAGGCCAGTCCGGGTCCAGCCACGAG
CCGGTACTTCATGCCCTCACTCAGTATGTCGTGCCGTACGGGAACGTCGTCCTTCCGCGACCACATGGGTCTTTG
GGCGACCCTTCGACGCTGGTCATGACAAGCACGACGACCCGGAACCTTGAGAACCTCGCATCCATGCTCCGACAA
GCGGACCCGATCCTGCTCCATGGGCCCTCGGGAGTTGGGAAAACTGCCCTGGTCCATGAGTTCGCCCAGCAGCTC
GGCACGTATGCCAACATGGTTACGCTGCACCTCAATGAGCAGACCGACGCCAAGATGCTTGTCGGCCTGTACTCG
ACAAACTCCAAACCCGGAAGCTTCCAGTGGCGCCCCGGCGTCCTGACCACCGCCGTCAAGGAGGGGAGATGGGTG
CTGATAGAGGATCTCGACCGGGCTCCCACAGAGGTCTTGAGCACCTTGCTACCACTGGTCGAGCGTAGAGAGCTC
CTCATACCCACCCGTGGGGAGAGGATACGTGCTGCCAAAAGTTTCCGTCTCTTCGCGACGGTTCGAACATCCCGT
GGCATGAACGGCCGAGAATCCCTGCCTAATCTTGTCGGTCTGCGATCCTGGCAATCTCTGCACACGCACCCCTTG
GTCTCATCCGAGCTGCAGGAGGTCGTTCTACAAACCTACCCGATCCTGCGGAAATTTGCGCCGGGCATCCTCGCC
GTTCACGAGCGTCTTTCTCTTCTCACAGGCAACCCTGCACTCATGTCCCGTGGACGGAGCGTCATGGACCGCCAG
ATGAGCTTGAGGGACCTTCTCAAATGGTGTCGCCGGCTGAGGGAATGCCTCCTGGCAGCGGGATCGACGTCGGGT
GACGAGCCAATCAGTGAGACCACGCGAGACTGGATGTTCATGGAAGCCCTGGATTGTTTCGTGGGAAGTTGTCCT
GATGTTGAGCTCGGCAAACAATTTGTACATGCCATCGCCGAGGAGATGCACATGTCCCGCGATAGGGCCGAGCAC
TTCCTGTCTGCTAATATACCTCATTTGGAAGAAAATGACCTCGTGTTCAGCATCGGGAGGGCTCAGCTTCGCAAG
ATGAAGGCGGCGGCCAGGCTGCAAAGGTCGAGGCGACCCTTCGCCAGCACCACCCACGCGAAGAAGCTCCTGGAA
CAGATCGCCGTGGCAGTGAGACTGCAAGAACCTGTCCTGCTGGTTGGCGAGACGGGAATTGGGAAAACGACAGTG
GTCCAGCAGCTAGCGGAATCACTGGGCCATAAGCTGATTGCCGTGAATCTCTCGCAACAGAGCGAGGTCGGAGAC
CTGCTGGGCGGTTTCAAGCCAGTCAATGTCCGCAGCCTTGCCGTTCCCCTGAAGGAGGAGTTCGAAGACCTCTTT
GCGGCAACAGGGATCTCTGCCTCCAAGAACCAGAAGTACCTGGAGCAGATTGGCAAGTCCTTCGCCAAGGGGCAA
TGGTCGAAATTGTCCAAGCTCTGGAGAGAGGCACCGAAGATGTTCGTTAAAATCATCGCCGAATTGGAGCGGATG
CAGTCCCAATCCCGCGACGACGATGCGCAACCGACAAAACGTCGCAAGACCCAGTCCAAGCTGCAGAGCCTGACA
GAACTGCGGCCACGATGGGATTCCTTCGCTCGCAATCTGGACCAGTTCGAGGTGCAGATATCGGGAGGATCTGGG
GGCTTTGCCTTTTCCTTCGTGGAGGGCAACCTGGTCAAAGCCGTCCGCAACGGCGACTGGGTTCTTCTGGACGAG
ATCAACCTTGCCTCCCCAGACACGCTAGAGAGCATCGCGGATCTCCTGAGCGGGCCAGACGAGCGGCCCTCGATC
CTGCTCGCGGAAACGGGAGAGCTGGAGAAGGTCGTCGCGCATCCAAACTTCCGCATCTTTGGCGCAATGAACCCT
GCTACCGACGTTGGCAAGAGGGATTTGCCCATCGGCATCAGGTCGAGGTTTACAGAACTCTACGTCAGGAGCCCC
GATGCGGATCACAAAGATCTGCTCACCATTGTCAAGGCGTACCTGGGAAGCAGCAGCACCAAGAGTGACCAGGCG
GCAGACGACATTGCGCGGCTGTACCTCAACACCAAACGCATGGCAGAGGAGAAACGGCTCGTCGACGGGGCCAAC
GAGGTCCCCCATTTCAGTTTGCGCACGCTGACCCGAGTGCTGAGTTATGTCAACACCATTGCCCCGCTGTACGGT
CTGCGGCGTGCCCTATACGAGGGCTTCTCCATGGGATTTCTCACCCTTCTAGACAGAGGTTCTGAGGACATGCTT
CTTCCGCTGATCTATCATCATCTCCTCGACAAGCATGGAAATCCCCAATCGCTCTTGTCGCAGCCACCCAAGCAT
CCCAACGACGGGAGGCGCTATGTCAAGTTCCAGAACCAGAAGCGCGACCGACAGTACTGGCTTTTTCAAGGCGAC
CAGACTCCAATCGAAAGAGACGACTACATCATCACCCCGTACGTGGAACGCAACCTCCTCAACATAGTTCGGGCG
ACCTCGACTCGACGGTTCCCAATCCTCATCCAAGGACCGACGTCGGCTGGAAAGACAAGCATGATTGAATACTTG
GCAAATTTCACGGGCAACAAATTTGTACGTATCAACAACCACGAGCATACCGATTTGCAGGAGTACCTCGGCACG
TACGTTTCCGGCCCGGACGGCAAGCTGCGTTTCCAAGAGGGTCTTCTCGTCCAAGCCATGCGTCAGGGCCACTGG
ATCGTGCTCGACGAGCTGAACCTTGCGCCGACTGATGTCCTGGAGGCTCTGAACCGTCTGCTGGACGACAATCGC
GAGCTTCTCATTCCAGAAACCCAAGAGGTAGTCCGGCCACACGAAAATTTCATTCTCTTTGCCACCCAAAATCCG
CCGGGCCTGTACGGCGGACGGAAGGTGTTGTCTCGAGCCTTCAGAAACAGATTCCTGGAGCTCCACTTTGACGAT
ATTCCAGAGGACGAACTAGAGTACATCCTGCAGCAGCGAAGCCGCAACACCTCTCCTCCGGATTGCCGACGCATC
GTCACCGTGTACAAAGAACTCTCTCGACTTCGTCAGACAAGCAGACTGTTCGAGCAAAAGGACAGTTTCGCCACG
TTGCGAGACCTGTTTCGCTGGGCCCTCAGGGATGCCGACACGAGGGAAGAGATCGCCGCACATGGGTTTATGCTG
CTGGCGGAAAGGGTCCGAGACGAGGAGGAGCGGATGGCTGTCAAAGGCATCATCGAGAAGGTCTTCAAGACTGAG
ATCAAGCCCGAAGAACTCTATTCGGCAGATGTTGCGACCGAGTTGAGACACTTGACCCGACAGCCCGGTGGCCAA
GACGTGGTCTGGACACGCGCGATGCGGCGGTTATATGTCCTGGTCTCCAGGGCTCTTCGCAACAACGAGCCTGTT
CTGCTCGTTGGCGAAACGGGTTGTGGCAAGACAACCGTCTGCCAGCTGCTCGCCGAGGCCCTCCAAAAGCAGCTG
AGCATCGTCAACGCACACCAGAACACAGAAACAGGCGATCTCATCGGTTCTCAAAGGCCTGTGCGAAATCGTGGT
GCGGTTATCGGGGCCTTGGATGCCGATCTGACGTCGGTGTTGGGCAATTTCGGACTGGTCGTCCCAAGCTCAACT
GACGAAAAGTTGCAAGCATACAGATCGCTGGATGAAAGCTCGATCTCAAAGATACCGCAGGAACTGGAGCAGCGC
ATCGCGGCCAACGAGACAAGGACGAAGGCGCTGTTCGAGTGGTCAGATGGAGCCCTGGTTGAGGCGATGCGCGGC
GGGCACTTTTTCCTGCTCGACGAGATCTCGCTTGCGGACGACTCTGTCCTGGAACGACTCAACTCGGTTCTGGAG
CCTCAGAGAACGCTACTTCTGGCTGAAAAGGGAATAGACAACTCGTTTGTCGTGGCATCTGATGGGTTCCAATTC
TTCGCCACGATGAACCCTGGCGGAGACTTCGGCAAGAAAGAGCTGTCGCCCGCCTTGCGCAATCGATTCACTGAA
ATCTGGGTGCCTCCACTGTCAGAGAATCATGACATTTACGAAATTGTGCGGTCGAAGCTTGCTGATGGGCGTAAG
CATCTCGTAGATGCTCTTGTCCAATTCGCTGTGTGGTTTGGGCCGACGTTCCGGCCCATGGCGACGACGCCGTTT
TCCGTGCGCGAGGTTCTTGCCTGCGTTCAGTTCATCAATACCTTTGAGACGGCCGACCCTGTCGAGTCCCTGGTC
CACGGGGCCTCGGCGATTTTCATTGATAGCATTGGAGCAAATCCCTCGGCCATGCTTGCTACCGATCTCAACGCC
ATCCACCAACAACGAGCAGAATGCCTCAAGACACTGGAACGACTGATTGGCCGCGACGTGTCCGATATATATGGA
TCTCGACCCGAGCTTGTGGTCACGGACGGTAGCTTGACTATTGGGAACTTCAGCGTCCCACGGTCCGCGACAAGC
ACGACTGGTACAGGATTCGCTTTCCACGCGCCAACGACAAGACTCAACGCTATGAGGGTTCTACGAGCGCTTCAA
GTTCACAAGCCCATCCTGCTGGAAGGCAGCCCCGGCGTTGGCAAGACATCTTTGGTCGCTGCGCTGGCACAGGCC
TGTGGCCGTCCGCTGACACGCATCAACCTGTCCGACCAGACAGATCTCATGGATCTCTTTGGAACGGATGTGCCT
GTCGAAGGGGAAGAGGCCGGGAATTTCGCATGGAGGGATGCCCCCTTCTTACAAGCAATGCAAAAGGGTGAGTGG
GTTCTTCTTGATGAGATGAATCTCGCCTCGCAATCGGTCCTGGAAGGTTTAAACGCCTGCCTTGACCATCGTGGC
GAGGTCTACATCTCTGAGCTCGACCAGGTCTTCAAGCGGCATCCCGACTTCCGTCTCTTTGCAGCTCAGAACCCT
CACCATCAAGGCGGGGGCCGCAAGGGTCTGCCCGCTTCCTTTGTCAATCGGTTCATCGTCGTCTACGCCGATATC
TTCAAAGACGAGGACCTGCGGCTTATCGCCTCTCATAACTTTCCCGATCTCTGCCCCAAAATCACCGGCCTCTTG
ATCGACTTTATCTCTCAGATGGATCATCAAGTTGTAGTCGAGAAATCCTTCGGAGCGCAGGGCGGCCCCTGGGAG
TTCAATCTCCGCGATGTCCTCAGATGGCTAGACCTGCTGAGCTCGTCTGATCCCCTACTTCGGACGGCCCGCGTC
GACGATTTTCTCAATATCATTGTGCGACAACGCTTTCGGACGCAAAAGGATCGAGAAGAGGTGGACAAGCTTTTC
GGCCGTCTCGCCGGATGGCAACCCCGGACACACTCATTCTACCACGACGTCAACTCGAGATTCAGCCAGGTCGGC
TTGGCCCTCCTGCACAGGAATACGATCTGTCAACCCGAAAGGCTGCCCAGCATAGACATTGTGGCTAGACTCCCC
GAGTTGGAGTCTTTGATGGAGGTTTTGAGCAGGCAGACCCGCTTCGAGAGGTGA
Transcript >Hirsu2|605
ATGATCGACGTCTCCCGGCAGAGGAGGTCGCTCCTGGAGGACGCGACTGCGCTCGATCATCTGCCGCCGGACTTG
CTGGAAATTATCCGGCATCATTCGTCGACGAACCTCCTGGACGCTGTCGCGCAGGCGGCTCTCAAGCCAGCACTT
ACAGAGCGCGTCTTCGCCCATTTCGAAAACGTCTTCCCCGACATTTGCGCGCGATGGATCCTCGACGCCCGGTCC
GCCACGCAGCAAACGTTGGCCGCCGCCGCCTTTGCCAGGGTTCTACCCTTTGCGCCCTATCTTTCAGAATTTCTC
AAGTGTTCGACTCAGGGGCCGCTGCCTGTGAATGAGAGGCCGTCGTCGCTACACCTGCCGCTGTCCCCGGTCGAC
GAACACTCGTCGTCTCAGCTGAATGTCGACGACCTGCTGCAGGTTCTACTCACGACATGGAGGTTGCTGAGCTTT
GACCTCCGCACATTCAAGCCTCTGGTTTCGCCGTCTTACATGCAGAGCTTGTTCCGACAGGAAAGCAGGGCTGTT
CGATATGTTGCAATTCGTATCTTCTGCCAGTTGCTTGATGCGGCCGACTTCAAGCTCGAGGCTCTCGTCAACGAG
CACTGTGGCCAGGAAGACGCCATCGTCGCCAACCTGGACGGAGCGCCCATAGACTTGGGCTTCTTGTCGCTGCAT
GAGCATGCCCGTGTCCAAAACGTCGTCACCTTGCGCGAACACGTGAAGCGAGGCCAGTCCGGGTCCAGCCACGAG
CCGGTACTTCATGCCCTCACTCAGTATGTCGTGCCGTACGGGAACGTCGTCCTTCCGCGACCACATGGGTCTTTG
GGCGACCCTTCGACGCTGGTCATGACAAGCACGACGACCCGGAACCTTGAGAACCTCGCATCCATGCTCCGACAA
GCGGACCCGATCCTGCTCCATGGGCCCTCGGGAGTTGGGAAAACTGCCCTGGTCCATGAGTTCGCCCAGCAGCTC
GGCACGTATGCCAACATGGTTACGCTGCACCTCAATGAGCAGACCGACGCCAAGATGCTTGTCGGCCTGTACTCG
ACAAACTCCAAACCCGGAAGCTTCCAGTGGCGCCCCGGCGTCCTGACCACCGCCGTCAAGGAGGGGAGATGGGTG
CTGATAGAGGATCTCGACCGGGCTCCCACAGAGGTCTTGAGCACCTTGCTACCACTGGTCGAGCGTAGAGAGCTC
CTCATACCCACCCGTGGGGAGAGGATACGTGCTGCCAAAAGTTTCCGTCTCTTCGCGACGGTTCGAACATCCCGT
GGCATGAACGGCCGAGAATCCCTGCCTAATCTTGTCGGTCTGCGATCCTGGCAATCTCTGCACACGCACCCCTTG
GTCTCATCCGAGCTGCAGGAGGTCGTTCTACAAACCTACCCGATCCTGCGGAAATTTGCGCCGGGCATCCTCGCC
GTTCACGAGCGTCTTTCTCTTCTCACAGGCAACCCTGCACTCATGTCCCGTGGACGGAGCGTCATGGACCGCCAG
ATGAGCTTGAGGGACCTTCTCAAATGGTGTCGCCGGCTGAGGGAATGCCTCCTGGCAGCGGGATCGACGTCGGGT
GACGAGCCAATCAGTGAGACCACGCGAGACTGGATGTTCATGGAAGCCCTGGATTGTTTCGTGGGAAGTTGTCCT
GATGTTGAGCTCGGCAAACAATTTGTACATGCCATCGCCGAGGAGATGCACATGTCCCGCGATAGGGCCGAGCAC
TTCCTGTCTGCTAATATACCTCATTTGGAAGAAAATGACCTCGTGTTCAGCATCGGGAGGGCTCAGCTTCGCAAG
ATGAAGGCGGCGGCCAGGCTGCAAAGGTCGAGGCGACCCTTCGCCAGCACCACCCACGCGAAGAAGCTCCTGGAA
CAGATCGCCGTGGCAGTGAGACTGCAAGAACCTGTCCTGCTGGTTGGCGAGACGGGAATTGGGAAAACGACAGTG
GTCCAGCAGCTAGCGGAATCACTGGGCCATAAGCTGATTGCCGTGAATCTCTCGCAACAGAGCGAGGTCGGAGAC
CTGCTGGGCGGTTTCAAGCCAGTCAATGTCCGCAGCCTTGCCGTTCCCCTGAAGGAGGAGTTCGAAGACCTCTTT
GCGGCAACAGGGATCTCTGCCTCCAAGAACCAGAAGTACCTGGAGCAGATTGGCAAGTCCTTCGCCAAGGGGCAA
TGGTCGAAATTGTCCAAGCTCTGGAGAGAGGCACCGAAGATGTTCGTTAAAATCATCGCCGAATTGGAGCGGATG
CAGTCCCAATCCCGCGACGACGATGCGCAACCGACAAAACGTCGCAAGACCCAGTCCAAGCTGCAGAGCCTGACA
GAACTGCGGCCACGATGGGATTCCTTCGCTCGCAATCTGGACCAGTTCGAGGTGCAGATATCGGGAGGATCTGGG
GGCTTTGCCTTTTCCTTCGTGGAGGGCAACCTGGTCAAAGCCGTCCGCAACGGCGACTGGGTTCTTCTGGACGAG
ATCAACCTTGCCTCCCCAGACACGCTAGAGAGCATCGCGGATCTCCTGAGCGGGCCAGACGAGCGGCCCTCGATC
CTGCTCGCGGAAACGGGAGAGCTGGAGAAGGTCGTCGCGCATCCAAACTTCCGCATCTTTGGCGCAATGAACCCT
GCTACCGACGTTGGCAAGAGGGATTTGCCCATCGGCATCAGGTCGAGGTTTACAGAACTCTACGTCAGGAGCCCC
GATGCGGATCACAAAGATCTGCTCACCATTGTCAAGGCGTACCTGGGAAGCAGCAGCACCAAGAGTGACCAGGCG
GCAGACGACATTGCGCGGCTGTACCTCAACACCAAACGCATGGCAGAGGAGAAACGGCTCGTCGACGGGGCCAAC
GAGGTCCCCCATTTCAGTTTGCGCACGCTGACCCGAGTGCTGAGTTATGTCAACACCATTGCCCCGCTGTACGGT
CTGCGGCGTGCCCTATACGAGGGCTTCTCCATGGGATTTCTCACCCTTCTAGACAGAGGTTCTGAGGACATGCTT
CTTCCGCTGATCTATCATCATCTCCTCGACAAGCATGGAAATCCCCAATCGCTCTTGTCGCAGCCACCCAAGCAT
CCCAACGACGGGAGGCGCTATGTCAAGTTCCAGAACCAGAAGCGCGACCGACAGTACTGGCTTTTTCAAGGCGAC
CAGACTCCAATCGAAAGAGACGACTACATCATCACCCCGTACGTGGAACGCAACCTCCTCAACATAGTTCGGGCG
ACCTCGACTCGACGGTTCCCAATCCTCATCCAAGGACCGACGTCGGCTGGAAAGACAAGCATGATTGAATACTTG
GCAAATTTCACGGGCAACAAATTTGTACGTATCAACAACCACGAGCATACCGATTTGCAGGAGTACCTCGGCACG
TACGTTTCCGGCCCGGACGGCAAGCTGCGTTTCCAAGAGGGTCTTCTCGTCCAAGCCATGCGTCAGGGCCACTGG
ATCGTGCTCGACGAGCTGAACCTTGCGCCGACTGATGTCCTGGAGGCTCTGAACCGTCTGCTGGACGACAATCGC
GAGCTTCTCATTCCAGAAACCCAAGAGGTAGTCCGGCCACACGAAAATTTCATTCTCTTTGCCACCCAAAATCCG
CCGGGCCTGTACGGCGGACGGAAGGTGTTGTCTCGAGCCTTCAGAAACAGATTCCTGGAGCTCCACTTTGACGAT
ATTCCAGAGGACGAACTAGAGTACATCCTGCAGCAGCGAAGCCGCAACACCTCTCCTCCGGATTGCCGACGCATC
GTCACCGTGTACAAAGAACTCTCTCGACTTCGTCAGACAAGCAGACTGTTCGAGCAAAAGGACAGTTTCGCCACG
TTGCGAGACCTGTTTCGCTGGGCCCTCAGGGATGCCGACACGAGGGAAGAGATCGCCGCACATGGGTTTATGCTG
CTGGCGGAAAGGGTCCGAGACGAGGAGGAGCGGATGGCTGTCAAAGGCATCATCGAGAAGGTCTTCAAGACTGAG
ATCAAGCCCGAAGAACTCTATTCGGCAGATGTTGCGACCGAGTTGAGACACTTGACCCGACAGCCCGGTGGCCAA
GACGTGGTCTGGACACGCGCGATGCGGCGGTTATATGTCCTGGTCTCCAGGGCTCTTCGCAACAACGAGCCTGTT
CTGCTCGTTGGCGAAACGGGTTGTGGCAAGACAACCGTCTGCCAGCTGCTCGCCGAGGCCCTCCAAAAGCAGCTG
AGCATCGTCAACGCACACCAGAACACAGAAACAGGCGATCTCATCGGTTCTCAAAGGCCTGTGCGAAATCGTGGT
GCGGTTATCGGGGCCTTGGATGCCGATCTGACGTCGGTGTTGGGCAATTTCGGACTGGTCGTCCCAAGCTCAACT
GACGAAAAGTTGCAAGCATACAGATCGCTGGATGAAAGCTCGATCTCAAAGATACCGCAGGAACTGGAGCAGCGC
ATCGCGGCCAACGAGACAAGGACGAAGGCGCTGTTCGAGTGGTCAGATGGAGCCCTGGTTGAGGCGATGCGCGGC
GGGCACTTTTTCCTGCTCGACGAGATCTCGCTTGCGGACGACTCTGTCCTGGAACGACTCAACTCGGTTCTGGAG
CCTCAGAGAACGCTACTTCTGGCTGAAAAGGGAATAGACAACTCGTTTGTCGTGGCATCTGATGGGTTCCAATTC
TTCGCCACGATGAACCCTGGCGGAGACTTCGGCAAGAAAGAGCTGTCGCCCGCCTTGCGCAATCGATTCACTGAA
ATCTGGGTGCCTCCACTGTCAGAGAATCATGACATTTACGAAATTGTGCGGTCGAAGCTTGCTGATGGGCGTAAG
CATCTCGTAGATGCTCTTGTCCAATTCGCTGTGTGGTTTGGGCCGACGTTCCGGCCCATGGCGACGACGCCGTTT
TCCGTGCGCGAGGTTCTTGCCTGCGTTCAGTTCATCAATACCTTTGAGACGGCCGACCCTGTCGAGTCCCTGGTC
CACGGGGCCTCGGCGATTTTCATTGATAGCATTGGAGCAAATCCCTCGGCCATGCTTGCTACCGATCTCAACGCC
ATCCACCAACAACGAGCAGAATGCCTCAAGACACTGGAACGACTGATTGGCCGCGACGTGTCCGATATATATGGA
TCTCGACCCGAGCTTGTGGTCACGGACGGTAGCTTGACTATTGGGAACTTCAGCGTCCCACGGTCCGCGACAAGC
ACGACTGGTACAGGATTCGCTTTCCACGCGCCAACGACAAGACTCAACGCTATGAGGGTTCTACGAGCGCTTCAA
GTTCACAAGCCCATCCTGCTGGAAGGCAGCCCCGGCGTTGGCAAGACATCTTTGGTCGCTGCGCTGGCACAGGCC
TGTGGCCGTCCGCTGACACGCATCAACCTGTCCGACCAGACAGATCTCATGGATCTCTTTGGAACGGATGTGCCT
GTCGAAGGGGAAGAGGCCGGGAATTTCGCATGGAGGGATGCCCCCTTCTTACAAGCAATGCAAAAGGGTGAGTGG
GTTCTTCTTGATGAGATGAATCTCGCCTCGCAATCGGTCCTGGAAGGTTTAAACGCCTGCCTTGACCATCGTGGC
GAGGTCTACATCTCTGAGCTCGACCAGGTCTTCAAGCGGCATCCCGACTTCCGTCTCTTTGCAGCTCAGAACCCT
CACCATCAAGGCGGGGGCCGCAAGGGTCTGCCCGCTTCCTTTGTCAATCGGTTCATCGTCGTCTACGCCGATATC
TTCAAAGACGAGGACCTGCGGCTTATCGCCTCTCATAACTTTCCCGATCTCTGCCCCAAAATCACCGGCCTCTTG
ATCGACTTTATCTCTCAGATGGATCATCAAGTTGTAGTCGAGAAATCCTTCGGAGCGCAGGGCGGCCCCTGGGAG
TTCAATCTCCGCGATGTCCTCAGATGGCTAGACCTGCTGAGCTCGTCTGATCCCCTACTTCGGACGGCCCGCGTC
GACGATTTTCTCAATATCATTGTGCGACAACGCTTTCGGACGCAAAAGGATCGAGAAGAGGTGGACAAGCTTTTC
GGCCGTCTCGCCGGATGGCAACCCCGGACACACTCATTCTACCACGACGTCAACTCGAGATTCAGCCAGGTCGGC
TTGGCCCTCCTGCACAGGAATACGATCTGTCAACCCGAAAGGCTGCCCAGCATAGACATTGTGGCTAGACTCCCC
GAGTTGGAGTCTTTGATGGAGGTTTTGAGCAGGCAGACCCGCTTCGAGAGGTGA
Gene >Hirsu2|605
ATGATCGACGTCTCCCGGCAGAGGAGGTCGCTCCTGGAGGACGCGACTGCGCTCGATCATCTGCCGCCGGACTTG
CTGGAAATTATCCGGCATCATTCGTCGACGAACCTCCTGGACGCTGTCGCGCAGGCGGCTCTCAAGCCAGCACTT
ACAGAGCGCGTCTTCGCCCATTTCGAAAACGTCTTCCCCGACATTTGCGCGCGATGGATCCTCGACGCCCGGTCC
GCCACGCAGCAAACGTTGGCCGCCGCCGCCTTTGCCAGGGTTCTACCCTTTGCGCCCTATCTTTCAGAATTTCTC
AAGTGTTCGACTCAGGGGCCGCTGCCTGTGAATGAGAGGCCGTCGTCGCTACACCTGCCGCTGTCCCCGGTCGAC
GAACACTCGTCGTCTCAGCTGAATGTCGACGACCTGCTGCAGGTTCTACTCACGACATGGAGGTTGCTGAGCTTT
GACCTCCGCACATTCAAGCCTCTGGTTTCGCCGTCTTACATGCAGAGCTTGTTCCGACAGGAAAGCAGGGCTGTT
CGATATGTTGCAATTCGTATCTTCTGCCAGTTGCTTGATGCGGCCGACTTCAAGCTCGAGGCTCTCGTCAACGAG
CACTGTGGCCAGGAAGACGCCATCGTCGCCAACCTGGACGGAGCGCCCATAGACTTGGGCTTCTTGTCGCTGCAT
GAGCATGCCCGTGTCCAAAACGTCGTCACCTTGCGCGAACACGTGAAGCGAGGCCAGTCCGGGTCCAGCCACGAG
CCGGTACTTCATGCCCTCACTCAGTATGTCGTGCCGTACGGGAACGTCGTCCTTCCGCGACCACATGGGTCTTTG
GGCGACCCTTCGACGCTGGTCATGACAAGCACGACGACCCGGAACCTTGAGAACCTCGCATCCATGCTCCGACAA
GCGGACCCGATCCTGCTCCATGGGCCCTCGGGAGTTGGGAAAACTGCCCTGGTCCATGAGTTCGCCCAGCAGCTC
GGCACGTATGCCAACATGGTTACGCTGCACCTCAATGAGCAGACCGACGCCAAGATGCTTGTCGGCCTGTACTCG
ACAAACTCCAAACCCGGAAGCTTCCAGTGGCGCCCCGGCGTCCTGACCACCGCCGTCAAGGAGGGGAGATGGGTG
CTGATAGAGGATCTCGACCGGGCTCCCACAGAGGTCTTGAGCACCTTGCTACCACTGGTCGAGCGTAGAGAGCTC
CTCATACCCACCCGTGGGGAGAGGATACGTGCTGCCAAAAGTTTCCGTCTCTTCGCGACGGTTCGAACATCCCGT
GGCATGAACGGCCGAGAATCCCTGCCTAATCTTGTCGGTCTGCGATCCTGGCAATCTCTGCACACGCACCCCTTG
GTCTCATCCGAGCTGCAGGAGGTCGTTCTACAAACCTACCCGATCCTGCGGAAATTTGCGCCGGGCATCCTCGCC
GTTCACGAGCGTCTTTCTCTTCTCACAGGCAACCCTGCACTCATGTCCCGTGGACGGAGCGTCATGGACCGCCAG
ATGAGCTTGAGGGACCTTCTCAAATGGTGTCGCCGGCTGAGGGAATGCCTCCTGGCAGCGGGATCGACGTCGGGT
GACGAGCCAATCAGTGAGACCACGCGAGACTGGATGTTCATGGAAGCCCTGGATTGTTTCGTGGGAAGTTGTCCT
GATGTTGAGCTCGGCAAACAATTTGTACATGCCATCGCCGAGGAGATGCACATGTCCCGCGATAGGGCCGAGCAC
TTCCTGTCTGCTAATATACCTCATTTGGAAGAAAATGACCTCGTGTTCAGCATCGGGAGGGCTCAGCTTCGCAAG
ATGAAGGCGGCGGCCAGGCTGCAAAGGTCGAGGCGACCCTTCGCCAGCACCACCCACGCGAAGAAGCTCCTGGAA
CAGATCGCCGTGGCAGTGAGACTGCAAGAACCTGTCCTGCTGGTTGGCGAGACGGGAATTGGGAAAACGACAGTG
GTCCAGCAGCTAGCGGAATCACTGGGCCATAAGCTGATTGCCGTGAATCTCTCGCAACAGAGCGAGGTCGGAGAC
CTGCTGGGCGGTTTCAAGCCAGTCAATGTCCGCAGCCTTGCCGTTCCCCTGAAGGAGGAGTTCGAAGACCTCTTT
GCGGCAACAGGGATCTCTGCCTCCAAGAACCAGAAGTACCTGGAGCAGATTGGCAAGTCCTTCGCCAAGGGGCAA
TGGTCGAAATTGTCCAAGCTCTGGAGAGAGGCACCGAAGATGTTCGTTAAAATCATCGCCGAATTGGAGCGGATG
CAGTCCCAATCCCGCGACGACGATGCGCAACCGACAAAACGTCGCAAGACCCAGTCCAAGCTGCAGAGCCTGACA
GAACTGCGGCCACGATGGGATTCCTTCGCTCGCAATCTGGACCAGTTCGAGGTGCAGATATCGGGAGGATCTGGG
GGCTTTGCCTTTTCCTTCGTGGAGGGCAACCTGGTCAAAGCCGTCCGCAACGGCGACTGGGTTCTTCTGGACGAG
ATCAACCTTGCCTCCCCAGACACGCTAGAGAGCATCGCGGATCTCCTGAGCGGGCCAGACGAGCGGCCCTCGATC
CTGCTCGCGGAAACGGGAGAGCTGGAGAAGGTCGTCGCGCATCCAAACTTCCGCATCTTTGGCGCAATGAACCCT
GCTACCGACGTTGGCAAGAGGGATTTGCCCATCGGCATCAGGTCGAGGTTTACAGAACTCTACGTCAGGAGCCCC
GATGCGGATCACAAAGATCTGCTCACCATTGTCAAGGCGTACCTGGGAAGCAGCAGCACCAAGAGTGACCAGGCG
GCAGACGACATTGCGCGGCTGTACCTCAACACCAAACGCATGGCAGAGGAGAAACGGCTCGTCGACGGGGCCAAC
GAGGTCCCCCATTTCAGTTTGCGCACGCTGACCCGAGTGCTGAGTTATGTCAACACCATTGCCCCGCTGTACGGT
CTGCGGCGTGCCCTATACGAGGGCTTCTCCATGGGATTTCTCACCCTTCTAGACAGAGGTTCTGAGGACATGCTT
CTTCCGCTGATCTATCATCATCTCCTCGACAAGCATGGAAATCCCCAATCGCTCTTGTCGCAGCCACCCAAGCAT
CCCAACGACGGGAGGCGCTATGTCAAGTTCCAGAACCAGAAGCGCGACCGACAGTACTGGCTTTTTCAAGGCGAC
CAGACTCCAATCGAAAGAGACGACTACATCATCACCCCGTACGTGGAACGCAACCTCCTCAACATAGTTCGGGCG
ACCTCGACTCGACGGTTCCCAATCCTCATCCAAGGACCGACGTCGGCTGGAAAGACAAGCATGATTGAATACTTG
GCAAATTTCACGGGCAACAAATTTGTACGTATCAACAACCACGAGCATACCGATTTGCAGGAGTACCTCGGCACG
TACGTTTCCGGCCCGGACGGCAAGCTGCGTTTCCAAGAGGGTCTTCTCGTCCAAGCCATGCGTCAGGGCCACTGG
ATCGTGCTCGACGAGCTGAACCTTGCGCCGACTGATGTCCTGGAGGCTCTGAACCGTCTGCTGGACGACAATCGC
GAGCTTCTCATTCCAGAAACCCAAGAGGTAGTCCGGCCACACGAAAATTTCATTCTCTTTGCCACCCAAAATCCG
CCGGGCCTGTACGGCGGACGGAAGGTGTTGTCTCGAGCCTTCAGAAACAGATTCCTGGAGCTCCACTTTGACGAT
ATTCCAGAGGACGAACTAGAGTACATCCTGCAGCAGCGAAGCCGCAACACCTCTCCTCCGGATTGCCGACGCATC
GTCACCGTGTACAAAGAACTCTCTCGACTTCGTCAGACAAGCAGACTGTTCGAGCAAAAGGACAGTTTCGCCACG
TTGCGAGACCTGTTTCGCTGGGCCCTCAGGGATGCCGACACGAGGGAAGAGATCGCCGCACATGGGTTTATGCTG
CTGGCGGAAAGGGTCCGAGACGAGGAGGAGCGGATGGCTGTCAAAGGCATCATCGAGAAGGTCTTCAAGACTGAG
ATCAAGCCCGAAGAACTCTATTCGGCAGATGTTGCGACCGAGTTGAGACACTTGACCCGACAGCCCGGTGGCCAA
GACGTGGTCTGGACACGCGCGATGCGGCGGTTATATGTCCTGGTCTCCAGGGCTCTTCGCAACAACGAGCCTGTT
CTGCTCGTTGGCGAAACGGGTTGTGGCAAGACAACCGTCTGCCAGCTGCTCGCCGAGGCCCTCCAAAAGCAGCTG
AGCATCGTCAACGCACACCAGAACACAGAAACAGGCGATCTCATCGGTTCTCAAAGGCCTGTGCGAAATCGTGGT
GCGGTTATCGGGGCCTTGGATGCCGATCTGACGTCGGTGTTGGGCAATTTCGGACTGGTCGTCCCAAGCTCAACT
GACGAAAAGTTGCAAGCATACAGATCGCTGGATGAAAGCTCGATCTCAAAGATACCGCAGGAACTGGAGCAGCGC
ATCGCGGCCAACGAGACAAGGACGAAGGCGCTGTTCGAGTGGTCAGATGGAGCCCTGGTTGAGGCGATGCGCGGC
GGGCACTTTTTCCTGCTCGACGAGATCTCGCTTGCGGACGACTCTGTCCTGGAACGACTCAACTCGGTTCTGGAG
CCTCAGAGAACGCTACTTCTGGCTGAAAAGGGAATAGACAACTCGTTTGTCGTGGCATCTGATGGGTTCCAATTC
TTCGCCACGATGAACCCTGGCGGAGACTTCGGCAAGAAAGAGCTGTCGCCCGCCTTGCGCAATCGATTCACTGAA
ATCTGGGTGCCTCCACTGTCAGAGAATCATGACATTTACGAAATTGTGCGGTCGAAGCTTGCTGATGGGCGTAAG
CATCTCGTAGATGCTCTTGTCCAATTCGCTGTGTGGTTTGGGCCGACGTTCCGGCCCATGGCGACGACGCCGTTT
TCCGTGCGCGAGGTTCTTGCCTGCGTTCAGTTCATCAATACCTTTGAGACGGCCGACCCTGTCGAGTCCCTGGTC
CACGGGGCCTCGGCGATTTTCATTGATAGCATTGGAGCAAATCCCTCGGCCATGCTTGCTACCGATCTCAACGCC
ATCCACCAACAACGAGCAGAATGCCTCAAGACACTGGAACGACTGATTGGCCGCGACGTGTCCGATATATATGGA
TCTCGACCCGAGCTTGTGGTCACGGACGGTAGCTTGACTATTGGGAACTTCAGCGTCCCACGGTCCGCGACAAGC
ACGACTGGTACAGGATTCGCTTTCCACGCGCCAACGACAAGACTCAACGCTATGAGGGTTCTACGAGCGCTTCAA
GTTCACAAGCCCATCCTGCTGGAAGGCAGCCCCGGCGTTGGCAAGACATCTTTGGTCGCTGCGCTGGCACAGGCC
TGTGGCCGTCCGCTGACACGCATCAACCTGTCCGACCAGACAGATCTCATGGATCTCTTTGGAACGGATGTGCCT
GTCGAAGGGGAAGAGGCCGGGAATTTCGCATGGAGGGATGCCCCCTTCTTACAAGCAATGCAAAAGGGTGAGTGG
GTTCTTCTTGATGAGATGAATCTCGCCTCGCAATCGGTCCTGGAAGGTTTAAACGCCTGCCTTGACCATCGTGGC
GAGGTCTACATCTCTGAGCTCGACCAGGTCTTCAAGCGGCATCCCGACTTCCGTCTCTTTGCAGCTCAGAACCCT
CACCATCAAGGCGGGGGCCGCAAGGGTCTGCCCGCTTCCTTTGTCAATCGGTTCATCGTCGTCTACGCCGATATC
TTCAAAGACGAGGACCTGCGGCTTATCGCCTCTCATAACTTTCCCGATCTCTGCCCCAAAATCACCGGCCTCTTG
ATCGACTTTATCTCTCAGATGGATCATCAAGTTGTAGTCGAGAAATCCTTCGGAGCGCAGGGCGGCCCCTGGGAG
TTCAATCTCCGCGATGTCCTCAGATGGCTAGACCTGCTGAGCTCGTCTGATCCCCTACTTCGGACGGCCCGCGTC
GACGATTTTCTCAATATCATTGTGCGACAACGCTTTCGGACGCAAAAGGATCGAGAAGAGGTGGACAAGCTTTTC
GGCCGTCTCGCCGGATGGCAACCCCGGACACACTCATTCTACCACGACGTCAACTCGAGATTCAGCCAGGTCGGC
TTGGCCCTCCTGCACAGGAATACGATCTGTCAACCCGAAAGGCTGCCCAGCATAGACATTGTGGCTAGACTCCCC
GAGTTGGAGTCTTTGATGGTCTGTGTCGAGAAGAATGTTCCCTGCATCCTAAGCAGTCCATCCGGATTTGGGAAA
TCTGCGCTATTGACGTACGTCGCGGCGCTGGCAGGCAAGCCCCTCGTGGTGTTTCCAATGAACGCCGACGTCGAC
ACGATGGACCTAGTAGGAGGTTTTGAGCAGGCAGACCCGCTTCGAGAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail