Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6049
Gene name
LocationContig_306:265..1504
Strand-
Gene length (bp)1239
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01979 Amidohydro_1 Amidohydrolase family 5.5E-28 76 370
PF07969 Amidohydro_3 Amidohydrolase family 1.2E-08 160 370

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A8AZ63|HUTI_STRGC Imidazolonepropionase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=hutI PE=3 SV=1 16 349 5.0E-06
sp|O27549|DADD_METTH 5'-deoxyadenosine deaminase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=dadD PE=3 SV=1 44 349 6.0E-06

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6049
MFPARTISAVCLLALAHLRHARALTISNVAVIDVNTGEVQPPQNVIIEGNKIARMEQAGGEAAAGAADTIDGTGK
FVMPGLCDMHVHAYFSNDPERFKVTDNFTFPLMIANGVTCVRDLGSNLEAIKSGRDRIAAHQLDGPPRIFLTGPM
LDGPNSTFQTALQLNTPDEARQAVRSLKDQGVDYIKVHLKPSREVFDAIAEEAKAARMSFGGHVPDSITAQDAVD
AGMNFIEHMSRTEANDSKLIESVVEKKVWQCPTLKLNPAQERLDLTKMLFEAGALMVAGTDSPAGKNLCPGVSLL
DELELMHRAGLSQLQTLQAATRNAADSVGMLSKMGTLETGKMADLVLLDENPLEDIGNVRKIRAVVADGQLYERE
KLDEMLSRADKLVQCNRGGKLAARDLISAAPSCCSAH*
Coding >Hirsu2|6049
ATGTTCCCGGCGCGGACGATAAGTGCCGTCTGTCTGTTAGCATTGGCTCATCTGAGACACGCGCGGGCGCTCACT
ATCAGCAACGTCGCCGTCATCGACGTCAACACGGGCGAGGTCCAACCGCCACAGAATGTCATCATCGAGGGCAAC
AAGATCGCCCGGATGGAGCAGGCCGGGGGCGAGGCGGCGGCGGGCGCCGCGGACACGATCGACGGCACGGGAAAG
TTCGTGATGCCGGGCCTGTGCGATATGCACGTCCACGCGTACTTCAGCAACGATCCCGAGAGGTTCAAGGTGACG
GACAACTTCACGTTCCCGCTGATGATCGCCAACGGCGTGACGTGCGTCCGCGACCTCGGCAGCAATCTCGAGGCC
ATCAAGTCCGGGCGCGACCGGATCGCGGCCCATCAGCTCGACGGCCCGCCGCGCATCTTCCTGACGGGCCCGATG
CTCGACGGGCCCAACTCGACGTTCCAGACGGCGCTGCAACTCAATACGCCCGACGAGGCGCGCCAGGCGGTCCGG
TCGCTCAAGGATCAGGGCGTCGACTACATCAAGGTCCACCTGAAGCCGTCCCGAGAGGTGTTCGATGCGATAGCG
GAGGAGGCCAAGGCCGCACGCATGTCTTTCGGCGGCCACGTGCCCGACTCCATCACCGCGCAGGATGCCGTCGAC
GCCGGCATGAACTTCATCGAGCACATGAGCCGCACCGAGGCCAATGACAGCAAGCTCATCGAGTCGGTCGTGGAG
AAGAAGGTCTGGCAGTGCCCCACGCTTAAGCTCAACCCGGCCCAGGAGCGGCTGGACCTGACCAAGATGCTCTTC
GAGGCCGGGGCGCTGATGGTCGCCGGCACGGACTCGCCGGCCGGCAAGAACCTGTGTCCGGGCGTGAGTCTCCTG
GACGAGCTCGAGCTCATGCACCGGGCCGGCCTCTCGCAGCTGCAGACACTCCAGGCGGCGACGAGGAACGCGGCC
GACTCGGTCGGCATGCTCTCCAAGATGGGTACGCTCGAGACCGGCAAGATGGCGGATCTGGTCCTGCTGGACGAG
AACCCGTTGGAGGATATTGGAAACGTGCGCAAGATCCGCGCCGTCGTGGCTGACGGCCAACTCTACGAGCGGGAG
AAGCTCGACGAGATGCTCTCGCGCGCCGACAAGCTGGTTCAGTGCAATAGAGGCGGCAAGCTTGCTGCCAGAGAT
TTGATCAGCGCCGCGCCTTCGTGCTGTTCAGCGCACTGA
Transcript >Hirsu2|6049
ATGTTCCCGGCGCGGACGATAAGTGCCGTCTGTCTGTTAGCATTGGCTCATCTGAGACACGCGCGGGCGCTCACT
ATCAGCAACGTCGCCGTCATCGACGTCAACACGGGCGAGGTCCAACCGCCACAGAATGTCATCATCGAGGGCAAC
AAGATCGCCCGGATGGAGCAGGCCGGGGGCGAGGCGGCGGCGGGCGCCGCGGACACGATCGACGGCACGGGAAAG
TTCGTGATGCCGGGCCTGTGCGATATGCACGTCCACGCGTACTTCAGCAACGATCCCGAGAGGTTCAAGGTGACG
GACAACTTCACGTTCCCGCTGATGATCGCCAACGGCGTGACGTGCGTCCGCGACCTCGGCAGCAATCTCGAGGCC
ATCAAGTCCGGGCGCGACCGGATCGCGGCCCATCAGCTCGACGGCCCGCCGCGCATCTTCCTGACGGGCCCGATG
CTCGACGGGCCCAACTCGACGTTCCAGACGGCGCTGCAACTCAATACGCCCGACGAGGCGCGCCAGGCGGTCCGG
TCGCTCAAGGATCAGGGCGTCGACTACATCAAGGTCCACCTGAAGCCGTCCCGAGAGGTGTTCGATGCGATAGCG
GAGGAGGCCAAGGCCGCACGCATGTCTTTCGGCGGCCACGTGCCCGACTCCATCACCGCGCAGGATGCCGTCGAC
GCCGGCATGAACTTCATCGAGCACATGAGCCGCACCGAGGCCAATGACAGCAAGCTCATCGAGTCGGTCGTGGAG
AAGAAGGTCTGGCAGTGCCCCACGCTTAAGCTCAACCCGGCCCAGGAGCGGCTGGACCTGACCAAGATGCTCTTC
GAGGCCGGGGCGCTGATGGTCGCCGGCACGGACTCGCCGGCCGGCAAGAACCTGTGTCCGGGCGTGAGTCTCCTG
GACGAGCTCGAGCTCATGCACCGGGCCGGCCTCTCGCAGCTGCAGACACTCCAGGCGGCGACGAGGAACGCGGCC
GACTCGGTCGGCATGCTCTCCAAGATGGGTACGCTCGAGACCGGCAAGATGGCGGATCTGGTCCTGCTGGACGAG
AACCCGTTGGAGGATATTGGAAACGTGCGCAAGATCCGCGCCGTCGTGGCTGACGGCCAACTCTACGAGCGGGAG
AAGCTCGACGAGATGCTCTCGCGCGCCGACAAGCTGGTTCAGTGCAATAGAGGCGGCAAGCTTGCTGCCAGAGAT
TTGATCAGCGCCGCGCCTTCGTGCTGTTCAGCGCACTGA
Gene >Hirsu2|6049
ATGTTCCCGGCGCGGACGATAAGTGCCGTCTGTCTGTTAGCATTGGCTCATCTGAGACACGCGCGGGCGCTCACT
ATCAGCAACGTCGCCGTCATCGACGTCAACACGGGCGAGGTCCAACCGCCACAGAATGTCATCATCGAGGGCAAC
AAGATCGCCCGGATGGAGCAGGCCGGGGGCGAGGCGGCGGCGGGCGCCGCGGACACGATCGACGGCACGGGAAAG
TTCGTGATGCCGGGCCTGTGCGATATGCACGTCCACGCGTACTTCAGCAACGATCCCGAGAGGTTCAAGGTGACG
GACAACTTCACGTTCCCGCTGATGATCGCCAACGGCGTGACGTGCGTCCGCGACCTCGGCAGCAATCTCGAGGCC
ATCAAGTCCGGGCGCGACCGGATCGCGGCCCATCAGCTCGACGGCCCGCCGCGCATCTTCCTGACGGGCCCGATG
CTCGACGGGCCCAACTCGACGTTCCAGACGGCGCTGCAACTCAATACGCCCGACGAGGCGCGCCAGGCGGTCCGG
TCGCTCAAGGATCAGGGCGTCGACTACATCAAGGTCCACCTGAAGCCGTCCCGAGAGGTGTTCGATGCGATAGCG
GAGGAGGCCAAGGCCGCACGCATGTCTTTCGGCGGCCACGTGCCCGACTCCATCACCGCGCAGGATGCCGTCGAC
GCCGGCATGAACTTCATCGAGCACATGAGCCGCACCGAGGCCAATGACAGCAAGCTCATCGAGTCGGTCGTGGAG
AAGAAGGTCTGGCAGTGCCCCACGCTTAAGCTCAACCCGGCCCAGGAGCGGCTGGACCTGACCAAGATGCTCTTC
GAGGCCGGGGCGCTGATGGTCGCCGGCACGGACTCGCCGGCCGGCAAGAACCTGTGTCCGGGCGTGAGTCTCCTG
GACGAGCTCGAGCTCATGCACCGGGCCGGCCTCTCGCAGCTGCAGACACTCCAGGCGGCGACGAGGAACGCGGCC
GACTCGGTCGGCATGCTCTCCAAGATGGGTACGCTCGAGACCGGCAAGATGGCGGATCTGGTCCTGCTGGACGAG
AACCCGTTGGAGGATATTGGAAACGTGCGCAAGATCCGCGCCGTCGTGGCTGACGGCCAACTCTACGAGCGGGAG
AAGCTCGACGAGATGCTCTCGCGCGCCGACAAGCTGGTTCAGTGCAATAGAGGCGGCAAGCTTGCTGCCAGAGAT
TTGATCAGCGCCGCGCCTTCGTGCTGTTCAGCGCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail