Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6048
Gene name
LocationContig_3059:44..1401
Strand-
Gene length (bp)1357
Transcript length (bp)1266
Coding sequence length (bp)1266
Protein length (aa) 422

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 2.8E-36 61 271
PF06422 PDR_CDR CDR ABC transporter 8.6E-20 284 370

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 55 367 2.0E-52
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 40 408 3.0E-50
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 40 408 3.0E-50
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 54 367 8.0E-50
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 40 381 5.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 55 367 2.0E-52
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 40 408 3.0E-50
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 40 408 3.0E-50
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 54 367 8.0E-50
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 40 381 5.0E-48
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 55 367 6.0E-48
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 54 384 1.0E-47
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 40 408 1.0E-47
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 55 367 5.0E-47
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 43 367 4.0E-46
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 54 367 7.0E-44
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 55 346 6.0E-42
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 55 364 1.0E-41
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 55 365 1.0E-39
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 51 376 3.0E-38
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 43 351 5.0E-38
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 55 384 1.0E-36
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 55 370 7.0E-36
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 43 382 2.0E-35
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 43 333 3.0E-34
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 43 333 5.0E-34
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 28 386 2.0E-33
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 92 354 4.0E-31
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 53 353 4.0E-30
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 55 370 8.0E-28
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 53 285 1.0E-20
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 47 341 1.0E-20
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 54 347 5.0E-19
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 47 341 2.0E-17
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 52 268 5.0E-16
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 65 271 4.0E-13
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 36 272 7.0E-13
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 54 284 1.0E-12
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 65 271 1.0E-12
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 55 279 4.0E-12
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 36 272 7.0E-12
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 11 271 8.0E-12
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 65 270 1.0E-11
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 65 270 1.0E-11
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 60 285 1.0E-11
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 64 271 1.0E-11
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 45 271 2.0E-11
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 41 344 2.0E-11
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 58 274 3.0E-11
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 41 344 5.0E-11
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 55 294 5.0E-11
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 45 271 1.0E-10
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 65 271 2.0E-10
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 65 387 5.0E-10
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 42 272 7.0E-10
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 55 344 7.0E-10
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 87 279 9.0E-10
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 64 271 1.0E-09
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 64 271 1.0E-09
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 65 271 2.0E-09
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 55 344 2.0E-09
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 55 272 2.0E-09
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 69 271 3.0E-09
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 65 271 5.0E-09
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 87 279 5.0E-09
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 61 257 6.0E-09
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 64 287 7.0E-09
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 52 279 8.0E-09
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 20 271 1.0E-08
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 65 271 2.0E-08
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 61 242 2.0E-08
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 59 283 3.0E-08
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 20 346 5.0E-08
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 72 285 6.0E-08
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 58 223 8.0E-08
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 54 271 1.0E-07
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 69 270 2.0E-07
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 14 278 2.0E-07
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 62 281 2.0E-07
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 80 278 3.0E-07
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 65 271 3.0E-07
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 65 271 5.0E-07
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 87 278 6.0E-07
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 52 271 7.0E-07
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 64 271 1.0E-06
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 59 283 1.0E-06
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 42 271 1.0E-06
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 50 344 1.0E-06
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 51 255 2.0E-06
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 114 271 2.0E-06
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 54 271 3.0E-06
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 20 284 5.0E-06
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 55 271 5.0E-06
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 65 271 5.0E-06
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 58 340 6.0E-06
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 88 270 7.0E-06
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 52 340 7.0E-06
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 64 271 7.0E-06
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 45 270 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0042626 ATPase activity, coupled to transmembrane movement of substances Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005524 ATP binding Yes
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0051234 establishment of localization No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0022804 active transmembrane transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0042623 ATPase activity, coupled No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043492 ATPase activity, coupled to movement of substances No
GO:0022857 transmembrane transporter activity No
GO:0015405 P-P-bond-hydrolysis-driven transmembrane transporter activity No
GO:0006810 transport No
GO:0016887 ATPase activity No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 83 102 19
2 114 136 22
3 156 178 22
4 190 212 22
5 222 241 19
6 248 267 19
7 332 354 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6048
LAREGAAAGDEFDAAVRGRRRRDGLLSRLLRPRLPASSCSASASSASAAGPPPVYQVGFHRQVWALMKRQFALRR
QDRFQLTLSWARSLAVALVLGTLYLRLGRTSGSAFGRGGLLFIALLFNAFQAFSELAGTLLGRAVLGKHRAYAFH
RPSALWIAQIVVDQAFAASEILLFSVVVYFMTGLARGPGAFFAFYLLILSGNVAMTLVFRIVGCLSPDFDYALRF
AVVVITLFVSTSGYLIQYQSERLWLRWIYWLNVLGLVFGALMDNEFSRLDLTCTADSLVPAGPGYDDIRHQVCTL
PGARPGTARVRGADYIASAFSYPPGGLWRNWAIVAAIILFFLGLNVVLGELVSFGAVGGDAVRVYQRPSRERDAL
NARLMERREARRRRLRAREEREGVGGEGGEERGGEEFLVRSESVLT*
Coding >Hirsu2|6048
CTGGCCCGCGAGGGCGCCGCCGCCGGCGACGAGTTCGACGCCGCGGTGCGCGGGCGCCGGCGTCGTGATGGCCTC
TTGTCGCGCCTCCTCCGGCCCCGGCTGCCCGCTTCTTCTTGTTCTGCCTCGGCCTCGTCGGCCTCGGCCGCGGGA
CCCCCGCCCGTCTACCAGGTCGGCTTCCACCGGCAGGTCTGGGCCCTGATGAAGCGGCAGTTCGCGCTGCGGCGG
CAGGACCGGTTCCAGCTGACGCTGTCGTGGGCGCGCAGCCTGGCCGTCGCCCTCGTCCTCGGCACGCTGTACCTG
CGGCTGGGGCGGACGTCGGGCAGCGCCTTTGGTCGCGGCGGCCTGCTCTTCATCGCGCTGCTCTTCAACGCCTTC
CAGGCCTTCTCCGAGCTGGCCGGCACCTTGCTCGGCCGGGCCGTGCTCGGCAAGCACCGCGCCTACGCCTTCCAC
CGGCCGTCGGCCCTGTGGATCGCCCAGATCGTCGTCGACCAGGCCTTCGCCGCGTCCGAGATCCTGCTCTTCTCC
GTCGTCGTCTACTTCATGACCGGCCTCGCCCGCGGGCCCGGCGCCTTCTTCGCCTTCTACCTGCTCATCCTGTCC
GGCAACGTGGCCATGACGCTCGTCTTCCGCATCGTCGGCTGCCTCAGCCCGGACTTCGACTACGCCCTCCGCTTC
GCCGTCGTCGTCATCACCTTGTTCGTCAGCACCTCGGGCTACCTGATCCAGTACCAGTCCGAGCGCCTCTGGCTG
CGCTGGATCTACTGGCTCAACGTCCTCGGCCTTGTCTTCGGCGCCCTCATGGACAACGAGTTCTCGCGCCTCGAC
CTGACCTGCACCGCCGACTCGCTCGTCCCCGCCGGCCCGGGCTACGACGACATCCGCCACCAGGTCTGCACCCTG
CCCGGCGCCCGGCCCGGCACCGCCCGCGTCCGCGGCGCCGACTACATCGCCAGCGCCTTCTCCTACCCGCCGGGC
GGCCTGTGGCGCAACTGGGCCATCGTCGCCGCCATCATCCTCTTCTTCCTCGGCCTCAACGTCGTCCTGGGCGAG
CTCGTCAGCTTCGGCGCCGTCGGCGGCGACGCCGTCCGCGTCTACCAGCGGCCCAGCCGCGAGCGCGACGCCCTC
AACGCCCGGCTGATGGAGCGGCGCGAGGCCCGGCGCCGGCGCCTTCGGGCCCGAGAGGAGAGGGAAGGGGTTGGA
GGGGAAGGGGGAGAGGAGCGAGGGGGGGAAGAGTTTCTCGTCCGGTCCGAGAGCGTCCTGACCTGA
Transcript >Hirsu2|6048
CTGGCCCGCGAGGGCGCCGCCGCCGGCGACGAGTTCGACGCCGCGGTGCGCGGGCGCCGGCGTCGTGATGGCCTC
TTGTCGCGCCTCCTCCGGCCCCGGCTGCCCGCTTCTTCTTGTTCTGCCTCGGCCTCGTCGGCCTCGGCCGCGGGA
CCCCCGCCCGTCTACCAGGTCGGCTTCCACCGGCAGGTCTGGGCCCTGATGAAGCGGCAGTTCGCGCTGCGGCGG
CAGGACCGGTTCCAGCTGACGCTGTCGTGGGCGCGCAGCCTGGCCGTCGCCCTCGTCCTCGGCACGCTGTACCTG
CGGCTGGGGCGGACGTCGGGCAGCGCCTTTGGTCGCGGCGGCCTGCTCTTCATCGCGCTGCTCTTCAACGCCTTC
CAGGCCTTCTCCGAGCTGGCCGGCACCTTGCTCGGCCGGGCCGTGCTCGGCAAGCACCGCGCCTACGCCTTCCAC
CGGCCGTCGGCCCTGTGGATCGCCCAGATCGTCGTCGACCAGGCCTTCGCCGCGTCCGAGATCCTGCTCTTCTCC
GTCGTCGTCTACTTCATGACCGGCCTCGCCCGCGGGCCCGGCGCCTTCTTCGCCTTCTACCTGCTCATCCTGTCC
GGCAACGTGGCCATGACGCTCGTCTTCCGCATCGTCGGCTGCCTCAGCCCGGACTTCGACTACGCCCTCCGCTTC
GCCGTCGTCGTCATCACCTTGTTCGTCAGCACCTCGGGCTACCTGATCCAGTACCAGTCCGAGCGCCTCTGGCTG
CGCTGGATCTACTGGCTCAACGTCCTCGGCCTTGTCTTCGGCGCCCTCATGGACAACGAGTTCTCGCGCCTCGAC
CTGACCTGCACCGCCGACTCGCTCGTCCCCGCCGGCCCGGGCTACGACGACATCCGCCACCAGGTCTGCACCCTG
CCCGGCGCCCGGCCCGGCACCGCCCGCGTCCGCGGCGCCGACTACATCGCCAGCGCCTTCTCCTACCCGCCGGGC
GGCCTGTGGCGCAACTGGGCCATCGTCGCCGCCATCATCCTCTTCTTCCTCGGCCTCAACGTCGTCCTGGGCGAG
CTCGTCAGCTTCGGCGCCGTCGGCGGCGACGCCGTCCGCGTCTACCAGCGGCCCAGCCGCGAGCGCGACGCCCTC
AACGCCCGGCTGATGGAGCGGCGCGAGGCCCGGCGCCGGCGCCTTCGGGCCCGAGAGGAGAGGGAAGGGGTTGGA
GGGGAAGGGGGAGAGGAGCGAGGGGGGGAAGAGTTTCTCGTCCGGTCCGAGAGCGTCCTGACCTGA
Gene >Hirsu2|6048
CTGGCCCGCGAGGGCGCCGCCGCCGGCGACGAGTTCGACGCCGCGGTGCGCGGGCGCCGGCGTCGTGATGGCCTC
TTGTCGCGCCTCCTCCGGCCCCGGCTGCCCGCTTCTTCTTGTTCTGCCTCGGCCTCGTCGGCCTCGGCCGCGGGA
CCCCCGCCCGTCTACCAGGTCGGCTTCCACCGGCAGGTCTGGGCCCTGATGAAGCGGCAGTTCGCGCTGCGGCGG
CAGGACCGGTTCCAGCTGACGCTGTCGTGGGCGCGCAGCCTGGCCGTCGCCCTCGTCCTCGGCACGCTGTACCTG
CGGCTGGGGCGGACGTCGGGCAGCGCCTTTGGTCGCGGCGGCCTGCTCTTCATCGCGCTGCTCTTCAACGCCTTC
CAGGCCTTCTCCGAGCTGGCCGGCACCTTGCTCGGCCGGGCCGTGCTCGGCAAGCACCGCGCCTACGCCTTCCAC
CGGCCGTCGGCCCTGTGGATCGCCCAGATCGTCGTCGACCAGGCCTTCGCCGCGTCCGAGATCCTGCTCTTCTCC
GTCGTCGTCTACTTCATGACCGGCCTCGCCCGCGGGCCCGGCGCCTTCTTCGCCTTCTACCTGCTCATCCTGTCC
GGCAACGTGGCCATGACGCTCGTCTTCCGCATCGTCGGCTGCCTCAGCCCGGACTTCGACTACGCCCTCCGCTTC
GCCGTCGTCGTCATCACCTTGTTCGTCAGCACCTCGGGCTACCTGATCCAGTACCAGTCCGAGCGCCTCTGGCTG
CGCTGGATCTACTGGCTCAACGTCCTCGGCCTTGTCTTCGGCGCCCTCATGGACAACGAGTTCTCGCGCCTCGAC
CTGACCTGCACCGCCGACTCGCTCGTCCCCGCCGGCCCGGGCTACGACGACATCCGCCACCAGGTCTGCACCCTG
CCCGGCGCCCGGCCCGGCACCGCCCGCGTCCGCGGCGCCGACTACATCGCCAGCGCCTTCTCCTACCCGCCGGGC
GGCCTGTGGCGCAACTGGGCCATCGTCGCCGCCATCATCCTCTTCTTCCTCGGCCTCAACGTCGTCCTGGGCGAG
CTCGTCAGCTTCGGCGCCGTCGGCGGCGACGCCGTCCGCGTCTACCAGCGGCCCAGCCGCGAGCGCGACGCCCTC
AACGCCCGGCTGATGGAGCGGCGCGAGGCCCGGCGCCGGCGCCTTCGGGCCCGAGAGGAGAGGGAAGGGGTTGGA
GGGGAAGGGGGAGAGGAGCGAGGGGGGGAAGAGTTTCTCGTCCGGTCCGAGAGCGTCCTGACGTGGGAGAGGCTC
AGCTACGACGTGCCCGTGGCCGGCGGCGGCACGCGGCGCCTGCTCGACGACGTGCACGGCTTCGTGCGGCCGGGC
CAGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail