Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6035
Gene name
LocationContig_3048:306..1379
Strand+
Gene length (bp)1073
Transcript length (bp)891
Coding sequence length (bp)891
Protein length (aa) 297

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04893 Yip1 Yip1 domain 1.3E-12 156 266

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6P8|YIP4_SCHPO Protein YIP4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.13c PE=1 SV=1 154 295 3.0E-37
sp|Q96EC8|YIPF6_HUMAN Protein YIPF6 OS=Homo sapiens GN=YIPF6 PE=1 SV=2 157 286 9.0E-30
sp|A6QLC6|YIPF6_BOVIN Protein YIPF6 OS=Bos taurus GN=YIPF6 PE=2 SV=1 157 286 2.0E-29
sp|Q8BR70|YIPF6_MOUSE Protein YIPF6 OS=Mus musculus GN=Yipf6 PE=1 SV=1 34 286 8.0E-28
sp|Q54RZ2|YIPF6_DICDI Protein YIPF6 homolog OS=Dictyostelium discoideum GN=yipf6 PE=3 SV=2 152 286 1.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6P8|YIP4_SCHPO Protein YIP4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.13c PE=1 SV=1 154 295 3.0E-37
sp|Q96EC8|YIPF6_HUMAN Protein YIPF6 OS=Homo sapiens GN=YIPF6 PE=1 SV=2 157 286 9.0E-30
sp|A6QLC6|YIPF6_BOVIN Protein YIPF6 OS=Bos taurus GN=YIPF6 PE=2 SV=1 157 286 2.0E-29
sp|Q8BR70|YIPF6_MOUSE Protein YIPF6 OS=Mus musculus GN=Yipf6 PE=1 SV=1 34 286 8.0E-28
sp|Q54RZ2|YIPF6_DICDI Protein YIPF6 homolog OS=Dictyostelium discoideum GN=yipf6 PE=3 SV=2 152 286 1.0E-27
sp|Q4QQU5|YIPF6_RAT Protein YIPF6 OS=Rattus norvegicus GN=Yipf6 PE=1 SV=1 157 286 4.0E-27
sp|Q28CH8|YIPF6_XENTR Protein YIPF6 OS=Xenopus tropicalis GN=yipf6 PE=2 SV=1 45 286 1.0E-26
sp|Q6IQ85|YIPF6_DANRE Protein YIPF6 OS=Danio rerio GN=yipf6 PE=2 SV=1 63 290 2.0E-24
sp|P53093|YIP4_YEAST Protein YIP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIP4 PE=1 SV=2 73 292 2.0E-11
sp|O94348|YIP1_SCHPO Protein transport protein yip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yip1 PE=3 SV=1 155 296 5.0E-11
sp|Q6NYF1|YIPF4_DANRE Protein YIPF4 OS=Danio rerio GN=yipf4 PE=2 SV=1 161 286 8.0E-07
sp|Q5ZJD7|YIPF4_CHICK Protein YIPF4 OS=Gallus gallus GN=YIPF4 PE=2 SV=1 161 286 5.0E-06
sp|Q9BSR8|YIPF4_HUMAN Protein YIPF4 OS=Homo sapiens GN=YIPF4 PE=1 SV=1 161 286 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 162 180 18
2 187 207 20
3 222 244 22
4 249 271 22
5 275 294 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6035
MASSTQGNSNPLLDNDELIDPDDADLNDFDDPLTPRANQSTLTRDTGSGLSPRPLSRTYLTSSIPGEDRRAPQNT
IDETAWETLRRDLLAVWAKLREVLYPSYLLDGTIFEPTGGLRGTYSNLRGAGIAGTREELTGLASRVVDTEALLQ
CNISHSLRDWDLWGPLIFCLLLSLLLSFTARPHQKDAVFSGVFALVWLGEAVVTLQIKLLGGNISFAQSVCIIGY
TLFPLVLAALMTALNLHWIARIPIYITLIAWSLAAGVSILGGSGVVKNRVILAVYPLFIFYGGLGCLCFMS*
Coding >Hirsu2|6035
ATGGCATCCAGCACTCAAGGCAATAGCAACCCTTTGTTGGACAACGACGAACTAATTGATCCCGATGATGCCGAT
TTGAACGACTTCGACGATCCTCTTACTCCCCGGGCTAATCAGTCAACACTCACGCGTGACACCGGCTCTGGACTT
TCACCTCGGCCTCTAAGCCGGACTTATTTGACCTCATCAATTCCGGGCGAGGACCGAAGAGCTCCGCAGAACACA
ATTGATGAGACGGCTTGGGAAACCCTTCGCCGCGATCTACTTGCTGTTTGGGCCAAGCTACGAGAAGTACTTTAT
CCAAGCTACTTGCTTGACGGGACCATTTTTGAACCGACAGGGGGCCTTCGCGGCACATATTCTAATCTCCGTGGC
GCCGGGATCGCTGGCACGAGAGAAGAGCTGACAGGTCTCGCCAGTCGTGTCGTAGACACTGAAGCGCTCTTGCAG
TGCAATATAAGTCACAGCTTAAGGGACTGGGACTTATGGGGACCGCTTATTTTCTGTCTGCTTCTCAGTCTACTC
CTGAGCTTCACCGCCCGCCCGCATCAAAAAGACGCAGTATTTAGCGGTGTCTTTGCTTTGGTTTGGCTCGGCGAA
GCAGTGGTAACGCTCCAAATAAAACTATTAGGCGGTAATATATCGTTCGCACAAAGCGTATGCATCATAGGCTAC
ACGCTCTTCCCTCTTGTCCTCGCTGCTCTTATGACCGCGCTGAACCTGCATTGGATCGCACGCATACCTATCTAC
ATCACCCTCATTGCATGGTCTCTCGCTGCGGGCGTAAGCATTCTAGGCGGTAGTGGCGTTGTTAAGAATCGAGTG
ATACTAGCTGTTTATCCGCTCTTTATTTTTTATGGCGGCTTAGGCTGCCTATGCTTTATGAGCTAG
Transcript >Hirsu2|6035
ATGGCATCCAGCACTCAAGGCAATAGCAACCCTTTGTTGGACAACGACGAACTAATTGATCCCGATGATGCCGAT
TTGAACGACTTCGACGATCCTCTTACTCCCCGGGCTAATCAGTCAACACTCACGCGTGACACCGGCTCTGGACTT
TCACCTCGGCCTCTAAGCCGGACTTATTTGACCTCATCAATTCCGGGCGAGGACCGAAGAGCTCCGCAGAACACA
ATTGATGAGACGGCTTGGGAAACCCTTCGCCGCGATCTACTTGCTGTTTGGGCCAAGCTACGAGAAGTACTTTAT
CCAAGCTACTTGCTTGACGGGACCATTTTTGAACCGACAGGGGGCCTTCGCGGCACATATTCTAATCTCCGTGGC
GCCGGGATCGCTGGCACGAGAGAAGAGCTGACAGGTCTCGCCAGTCGTGTCGTAGACACTGAAGCGCTCTTGCAG
TGCAATATAAGTCACAGCTTAAGGGACTGGGACTTATGGGGACCGCTTATTTTCTGTCTGCTTCTCAGTCTACTC
CTGAGCTTCACCGCCCGCCCGCATCAAAAAGACGCAGTATTTAGCGGTGTCTTTGCTTTGGTTTGGCTCGGCGAA
GCAGTGGTAACGCTCCAAATAAAACTATTAGGCGGTAATATATCGTTCGCACAAAGCGTATGCATCATAGGCTAC
ACGCTCTTCCCTCTTGTCCTCGCTGCTCTTATGACCGCGCTGAACCTGCATTGGATCGCACGCATACCTATCTAC
ATCACCCTCATTGCATGGTCTCTCGCTGCGGGCGTAAGCATTCTAGGCGGTAGTGGCGTTGTTAAGAATCGAGTG
ATACTAGCTGTTTATCCGCTCTTTATTTTTTATGGCGGCTTAGGCTGCCTATGCTTTATGAGCTAG
Gene >Hirsu2|6035
ATGGCATCCAGCACTCAAGGCAATAGCAACCCTTTGTTGGACAACGACGAACTAATTGATCCCGATGATGGTATG
GTTATTCGGTCGTTACATGCCACATATATGCCACGCTCCCCCTGTCGACCTCGTCGGACCTGGAACTGATTTTGG
TACTTCGCCTTAGCCGATTTGAACGACTTCGACGATCCTCTTACTCCCCGGGCTAATCAGTCAACACTCACGCGT
GACACCGGCTCTGGACTTTCACCTCGGCCTCTAAGCCGGACTTATTTGACCTCATCAATTCCGGGCGAGGACCGA
AGAGCTCCGCAGAACACAATTGATGAGACGGCTTGGGAAACCCTTCGCCGCGATCTACTTGCTGTTTGGGCCAAG
CTACGAGAAGTACTTTATCCAAGCTACTTGCTTGACGGGACCATTTTTGAACCGACAGGGGGCCTTCGCGGCACA
TATTCTAATCTCCGTGGCGCCGGGATCGCTGGCACGAGAGAAGAGCTGACAGGTCTCGCCAGTCGTGTCGTAGAC
ACTGAAGCGCTCTTGCAGTGCAATATAAGTCACAGCTTAAGGGACTGGGACTTATGGGGACCGCTTATTTTCTGT
CTGCTTCTCAGTCTACTCCTGAGCTTCACCGCCCGCCCGCATCAAAAAGACGCAGTATTTAGCGGTGTCTTTGCT
TTGGTTTGGCTCGGCGAAGCAGTGGTAACGCTCCAAATAAAACTATTAGGCGGTAATATGTACGTTATAACCGCA
ACCCGAAACTGCACTATCATCCTACAGACTCTCGTCTTGTCTACCCGCTGACGTTTGGCTGTCCTGCTACAAGAT
CGTTCGCACAAAGCGTATGCATCATAGGCTACACGCTCTTCCCTCTTGTCCTCGCTGCTCTTATGACCGCGCTGA
ACCTGCATTGGATCGCACGCATACCTATCTACATCACCCTCATTGCATGGTCTCTCGCTGCGGGCGTAAGCATTC
TAGGCGGTAGTGGCGTTGTTAAGAATCGAGTGATACTAGCTGTTTATCCGCTCTTTATTTTTTATGGCGGCTTAG
GCTGCCTATGCTTTATGAGCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail