Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6034
Gene name
LocationContig_3047:137..1338
Strand+
Gene length (bp)1201
Transcript length (bp)927
Coding sequence length (bp)927
Protein length (aa) 309

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 8.7E-06 107 129

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q870A3|PACC_FUSO4 pH-response transcription factor pacC/RIM101 OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) GN=pacC PE=1 SV=1 16 306 7.0E-150
sp|Q8J1U9|PACC_GIBFU pH-response transcription factor pacC/RIM101 OS=Gibberella fujikuroi GN=pacC PE=3 SV=1 16 306 9.0E-150
sp|Q873X0|PACC_GIBMO pH-response transcription factor pacC/RIM101 OS=Gibberella moniliformis GN=PAC1 PE=3 SV=1 16 306 5.0E-147
sp|Q96X49|PACC_ACRCH pH-response transcription factor pacC/RIM101 OS=Acremonium chrysogenum GN=pacC PE=1 SV=1 38 306 4.0E-129
sp|Q52B93|PACC_MAGO7 pH-response transcription factor pacC/RIM101 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM101 PE=3 SV=2 38 296 1.0E-94
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q870A3|PACC_FUSO4 pH-response transcription factor pacC/RIM101 OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) GN=pacC PE=1 SV=1 16 306 7.0E-150
sp|Q8J1U9|PACC_GIBFU pH-response transcription factor pacC/RIM101 OS=Gibberella fujikuroi GN=pacC PE=3 SV=1 16 306 9.0E-150
sp|Q873X0|PACC_GIBMO pH-response transcription factor pacC/RIM101 OS=Gibberella moniliformis GN=PAC1 PE=3 SV=1 16 306 5.0E-147
sp|Q96X49|PACC_ACRCH pH-response transcription factor pacC/RIM101 OS=Acremonium chrysogenum GN=pacC PE=1 SV=1 38 306 4.0E-129
sp|Q52B93|PACC_MAGO7 pH-response transcription factor pacC/RIM101 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM101 PE=3 SV=2 38 296 1.0E-94
sp|Q7RVQ8|PACC_NEUCR pH-response transcription factor pacc-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pacc-1 PE=3 SV=2 38 283 4.0E-88
sp|Q00202|PACC_EMENI pH-response transcription factor pacC/RIM101 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pacC PE=1 SV=1 10 296 1.0E-73
sp|Q9P413|PACC_SCLSC pH-response transcription factor pacC/RIM101 OS=Sclerotinia sclerotiorum GN=pac1 PE=2 SV=1 26 262 9.0E-72
sp|Q00203|PACC_ASPNG pH-response transcription factor pacC/RIM101 OS=Aspergillus niger GN=PACC PE=2 SV=1 39 286 8.0E-71
sp|Q8J257|PACC_PARBR pH-response transcription factor pacC/RIM101 OS=Paracoccidioides brasiliensis GN=pacC PE=3 SV=2 39 286 1.0E-70
sp|Q9HFB3|PACC_ASPOR pH-response transcription factor pacC/RIM101 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pacC PE=3 SV=2 39 286 2.0E-68
sp|Q96UW0|PACC_ASPPA pH-response transcription factor pacC/RIM101 OS=Aspergillus parasiticus GN=pacC PE=3 SV=1 39 286 5.0E-67
sp|Q4WY67|PACC_ASPFU pH-response transcription factor pacC/RIM101 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pacC PE=3 SV=1 37 286 7.0E-65
sp|Q9C1A4|PACC_TRIRU pH-response transcription factor pacC/RIM101 OS=Trichophyton rubrum GN=pacC PE=3 SV=2 40 284 4.0E-64
sp|Q5XL24|PACC_ASPGI pH-response transcription factor pacC/RIM101 OS=Aspergillus giganteus GN=pacC PE=3 SV=1 39 286 1.0E-63
sp|Q01864|PACC_PENCH pH-response transcription factor pacC/RIM101 OS=Penicillium chrysogenum GN=PACC PE=1 SV=2 33 277 1.0E-63
sp|P78978|PACC_YARLI pH-response transcription factor pacC/RIM101 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM101 PE=1 SV=1 19 259 2.0E-46
sp|Q9P8G9|PACC_COLSU pH-response transcription factor pacC/RIM101 (Fragment) OS=Colletotrichum sublineola GN=pacC PE=3 SV=1 62 132 3.0E-42
sp|Q873Y3|PACC_CANDC pH-response transcription factor pacC/RIM101 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=RIM101 PE=3 SV=2 16 132 1.0E-41
sp|Q753Y2|PACC_ASHGO pH-response transcription factor pacC/RIM101 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RIM101 PE=3 SV=1 20 137 2.0E-41
sp|Q9UW14|PACC_CANAL pH-response transcription factor pacC/RIM101 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RIM101 PE=1 SV=2 41 132 3.0E-41
sp|Q6BSZ4|PACC_DEBHA pH-response transcription factor pacC/RIM101 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RIM101 PE=3 SV=2 41 229 4.0E-41
sp|Q8J254|PACC_COLGL pH-response transcription factor pacC/RIM101 (Fragment) OS=Colletotrichum gloeosporioides GN=pac1 PE=2 SV=1 62 126 4.0E-39
sp|Q6H8R9|PACC_USTMA pH-response transcription factor pacC/RIM101 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PACC PE=3 SV=3 41 131 8.0E-39
sp|Q8J256|PACC_PENEC pH-response transcription factor pacC/RIM101 (Fragment) OS=Penicillium echinulatum GN=PACC PE=3 SV=1 60 129 2.0E-38
sp|Q6CQ07|PACC_KLULA pH-response transcription factor pacC/RIM101 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RIM101 PE=3 SV=1 20 137 2.0E-36
sp|P0CS62|PACC_CRYNJ pH-response transcription factor pacC/RIM101 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RIM101 PE=3 SV=1 29 129 1.0E-35
sp|P0CS63|PACC_CRYNB pH-response transcription factor pacC/RIM101 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RIM101 PE=3 SV=1 29 129 1.0E-35
sp|Q6FV94|PACC_CANGA pH-response transcription factor pacC/RIM101 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RIM101 PE=3 SV=1 17 140 3.0E-35
sp|P33400|PACC_YEAST pH-response transcription factor pacC/RIM101 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM101 PE=1 SV=2 38 131 7.0E-34
sp|Q874A5|PACC_PENEN pH-response transcription factor pacC/RIM101 (Fragment) OS=Penicillium expansum GN=PACC PE=3 SV=1 64 110 3.0E-23
sp|P34708|TRA1_CAEEL Sex-determining transformer protein 1 OS=Caenorhabditis elegans GN=tra-1 PE=1 SV=1 21 129 3.0E-15
sp|Q17308|TRA1_CAEBR Sex-determining transformer protein 1 OS=Caenorhabditis briggsae GN=tra-1 PE=1 SV=1 21 132 3.0E-14
sp|Q7K0S9|GLIS2_DROME Zinc finger protein GLIS2 homolog OS=Drosophila melanogaster GN=sug PE=2 SV=1 40 130 2.0E-11
sp|P47806|GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus GN=Gli1 PE=1 SV=4 43 132 5.0E-11
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 43 132 5.0E-11
sp|Q8VDL9|GLIS2_MOUSE Zinc finger protein GLIS2 OS=Mus musculus GN=Glis2 PE=1 SV=1 41 132 7.0E-11
sp|Q9BZE0|GLIS2_HUMAN Zinc finger protein GLIS2 OS=Homo sapiens GN=GLIS2 PE=1 SV=2 41 132 7.0E-11
sp|Q8CFA7|KLF17_MOUSE Krueppel-like factor 17 OS=Mus musculus GN=Klf17 PE=1 SV=2 22 129 2.0E-10
sp|P47043|ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZAP1 PE=1 SV=1 39 130 3.0E-10
sp|C7EMF5|KLF17_PIG Krueppel-like factor 17 OS=Sus scrofa GN=KLF17 PE=2 SV=1 43 129 9.0E-10
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 43 129 1.0E-09
sp|P10070|GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens GN=GLI2 PE=1 SV=4 43 132 1.0E-09
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 43 129 1.0E-09
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 43 129 1.0E-09
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 43 129 2.0E-09
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 43 129 2.0E-09
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 40 132 2.0E-09
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 40 132 2.0E-09
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 43 129 2.0E-09
sp|Q0VGT2|GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus GN=Gli2 PE=1 SV=2 43 132 2.0E-09
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 43 129 2.0E-09
sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens GN=KLF17 PE=1 SV=1 43 156 3.0E-09
sp|Q98T94|GLIS2_XENLA Zinc finger protein GLIS2 OS=Xenopus laevis GN=glis2 PE=2 SV=1 24 132 3.0E-09
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 43 129 3.0E-09
sp|Q6XP49|GLIS3_MOUSE Zinc finger protein GLIS3 OS=Mus musculus GN=Glis3 PE=1 SV=2 43 132 4.0E-09
sp|Q91690|GLI1_XENLA Zinc finger protein GLI1 (Fragment) OS=Xenopus laevis GN=gli1 PE=2 SV=2 43 132 4.0E-09
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 43 129 5.0E-09
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 43 129 5.0E-09
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 43 129 5.0E-09
sp|Q8NEA6|GLIS3_HUMAN Zinc finger protein GLIS3 OS=Homo sapiens GN=GLIS3 PE=2 SV=5 43 132 7.0E-09
sp|O95409|ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens GN=ZIC2 PE=1 SV=2 34 132 7.0E-09
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 43 129 8.0E-09
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 43 129 8.0E-09
sp|Q29W20|EGR1_BOVIN Early growth response protein 1 OS=Bos taurus GN=EGR1 PE=2 SV=1 43 129 8.0E-09
sp|Q62520|ZIC2_MOUSE Zinc finger protein ZIC 2 OS=Mus musculus GN=Zic2 PE=1 SV=2 34 132 8.0E-09
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 43 129 8.0E-09
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 43 129 9.0E-09
sp|P55878|GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus GN=GLI1 PE=2 SV=1 43 132 9.0E-09
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 43 129 1.0E-08
sp|Q91661|GLI4_XENLA Zinc finger protein GLI4 OS=Xenopus laevis GN=gli4 PE=2 SV=1 43 132 1.0E-08
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 34 132 1.0E-08
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 40 132 1.0E-08
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 48 129 2.0E-08
sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 40 132 2.0E-08
sp|P19538|CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster GN=ci PE=1 SV=2 43 130 2.0E-08
sp|Q8K1M4|GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus GN=Glis1 PE=2 SV=2 43 132 2.0E-08
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 48 129 2.0E-08
sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens GN=ZIC1 PE=2 SV=2 40 132 2.0E-08
sp|P46684|ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus GN=Zic1 PE=1 SV=2 40 132 3.0E-08
sp|Q8NBF1|GLIS1_HUMAN Zinc finger protein GLIS1 OS=Homo sapiens GN=GLIS1 PE=2 SV=2 43 132 3.0E-08
sp|Q9QZP2|PRDM4_RAT PR domain zinc finger protein 4 OS=Rattus norvegicus GN=Prdm4 PE=2 SV=1 44 141 4.0E-08
sp|Q5R5M1|PRDM4_PONAB PR domain zinc finger protein 4 OS=Pongo abelii GN=PRDM4 PE=2 SV=1 44 141 4.0E-08
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 48 129 5.0E-08
sp|Q9UKN5|PRDM4_HUMAN PR domain zinc finger protein 4 OS=Homo sapiens GN=PRDM4 PE=1 SV=3 44 141 5.0E-08
sp|Q80V63|PRDM4_MOUSE PR domain zinc finger protein 4 OS=Mus musculus GN=Prdm4 PE=2 SV=2 44 141 5.0E-08
sp|P55879|GLI2_CHICK Zinc finger protein GLI2 (Fragment) OS=Gallus gallus GN=GLI2 PE=2 SV=1 43 132 6.0E-08
sp|A0JC51|ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis GN=zic4 PE=2 SV=1 40 132 1.0E-07
sp|Q9IB89|ZIC5_XENLA Zinc finger protein ZIC 5 OS=Xenopus laevis GN=zic5 PE=2 SV=1 40 132 1.0E-07
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 41 148 1.0E-07
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 41 148 2.0E-07
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 41 148 2.0E-07
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 41 148 2.0E-07
sp|Q8N9L1|ZIC4_HUMAN Zinc finger protein ZIC 4 OS=Homo sapiens GN=ZIC4 PE=2 SV=3 40 132 2.0E-07
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 24 134 2.0E-07
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 48 153 3.0E-07
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 24 134 3.0E-07
sp|Q61467|ZIC4_MOUSE Zinc finger protein ZIC 4 OS=Mus musculus GN=Zic4 PE=1 SV=2 40 132 4.0E-07
sp|B1H2Q6|ZN865_XENTR Zinc finger protein 865 OS=Xenopus tropicalis GN=znf865 PE=2 SV=1 36 129 5.0E-07
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 40 132 5.0E-07
sp|Q01713|KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus GN=Klf9 PE=2 SV=1 8 137 8.0E-07
sp|Q64HY5|SP8_CHICK Transcription factor Sp8 OS=Gallus gallus GN=SP8 PE=2 SV=1 42 130 8.0E-07
sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens GN=ZIC5 PE=1 SV=2 48 132 9.0E-07
sp|Q9JJZ6|KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus GN=Klf13 PE=1 SV=2 43 145 9.0E-07
sp|Q9EPW2|KLF15_MOUSE Krueppel-like factor 15 OS=Mus musculus GN=Klf15 PE=1 SV=1 43 129 1.0E-06
sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens GN=KLF13 PE=1 SV=1 43 145 1.0E-06
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 42 129 1.0E-06
sp|P39933|TF3A_YEAST Transcription factor IIIA OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PZF1 PE=1 SV=1 43 139 1.0E-06
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 42 129 1.0E-06
sp|Q9UIH9|KLF15_HUMAN Krueppel-like factor 15 OS=Homo sapiens GN=KLF15 PE=1 SV=1 43 129 1.0E-06
sp|Q6FJQ9|ACE2_CANGA Cell wall transcription factor ACE2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACE2 PE=3 SV=1 55 129 2.0E-06
sp|Q9UFB7|ZBT47_HUMAN Zinc finger and BTB domain-containing protein 47 OS=Homo sapiens GN=ZBTB47 PE=2 SV=3 32 132 2.0E-06
sp|Q5XGT8|SP8_XENLA Transcription factor Sp8 OS=Xenopus laevis GN=sp8 PE=2 SV=1 42 129 2.0E-06
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 35 138 3.0E-06
sp|Q0VA40|SP9_XENTR Transcription factor Sp9 OS=Xenopus tropicalis GN=sp9 PE=2 SV=1 42 129 3.0E-06
sp|O14258|ACE2_SCHPO Metallothionein expression activator OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ace2 PE=3 SV=1 78 131 3.0E-06
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 42 129 3.0E-06
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 35 152 4.0E-06
sp|P0CG40|SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens GN=SP9 PE=3 SV=1 42 129 4.0E-06
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 35 129 5.0E-06
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 35 129 5.0E-06
sp|Q64HY3|SP9_MOUSE Transcription factor Sp9 OS=Mus musculus GN=Sp9 PE=1 SV=1 42 129 5.0E-06
sp|O95409|ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens GN=ZIC2 PE=1 SV=2 35 129 6.0E-06
sp|Q96JB3|HIC2_HUMAN Hypermethylated in cancer 2 protein OS=Homo sapiens GN=HIC2 PE=1 SV=2 44 132 6.0E-06
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 33 132 6.0E-06
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 22 130 6.0E-06
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 22 132 6.0E-06
sp|Q62520|ZIC2_MOUSE Zinc finger protein ZIC 2 OS=Mus musculus GN=Zic2 PE=1 SV=2 35 129 7.0E-06
sp|Q9JLZ6|HIC2_MOUSE Hypermethylated in cancer 2 protein OS=Mus musculus GN=Hic2 PE=2 SV=4 30 132 7.0E-06
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 33 129 7.0E-06
sp|Q9UKT9|IKZF3_HUMAN Zinc finger protein Aiolos OS=Homo sapiens GN=IKZF3 PE=1 SV=2 44 125 8.0E-06
sp|O35739|KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus GN=Klf9 PE=2 SV=1 8 129 8.0E-06
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 33 129 8.0E-06
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 34 132 8.0E-06
sp|Q9Z0Z7|KLF5_MOUSE Krueppel-like factor 5 OS=Mus musculus GN=Klf5 PE=2 SV=2 43 131 8.0E-06
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 34 132 9.0E-06
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 35 129 1.0E-05
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 82 169 1.0E-05
sp|O08900|IKZF3_MOUSE Zinc finger protein Aiolos OS=Mus musculus GN=Ikzf3 PE=1 SV=2 44 125 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6034
MASQLPDGSSASSNGNDSKSNTPAPSSATSTSSQHNADDNLTCRWNACNQKFGSPETLYEHICERHVGRKSTNNL
NLTCQWNACRTTTVKRDHITSHIRVHVPLKPHKCDFCGKSFKRPQDLKKHVKTHADDSMLARPGQDHQAGLNYRA
QAKGPSYYDHNGQMRGGVGGFPHPAGHNGSYYAPQPSTNYALYFSQPPLNGHRGEHVGYSAAAAAAAAAAGYDRK
RAYDRTYDAMDDFFGNAKRRQIDPSSYAQIGRSLLPLHNSLSVPNGQMTAPEQYMAQPAPAPAPAMVHSGPAPTT
NPLTQQRT*
Coding >Hirsu2|6034
ATGGCTTCACAGCTGCCCGACGGCTCGTCGGCCTCGAGCAACGGCAACGACTCCAAGTCCAACACGCCGGCGCCC
TCGAGCGCGACCTCGACCTCGTCCCAGCACAACGCCGACGACAACCTGACGTGCCGCTGGAACGCCTGCAACCAA
AAGTTCGGCAGCCCCGAGACGCTCTATGAGCACATCTGCGAGCGTCACGTCGGCCGCAAGAGCACCAACAACCTG
AACCTGACCTGCCAGTGGAACGCCTGCCGCACGACGACGGTCAAGCGCGACCACATCACCTCGCACATCCGCGTC
CATGTGCCGCTCAAGCCGCACAAGTGCGACTTTTGCGGAAAGTCGTTCAAGCGGCCTCAGGATCTCAAGAAGCAC
GTCAAGACCCACGCCGATGATTCCATGCTAGCCCGTCCGGGTCAGGACCACCAGGCAGGCCTCAACTACCGGGCG
CAAGCCAAAGGCCCCAGCTACTACGACCACAACGGCCAGATGCGCGGCGGCGTCGGCGGCTTCCCGCACCCGGCC
GGCCACAACGGCAGCTACTACGCCCCGCAGCCGTCGACCAACTATGCCCTCTACTTCAGCCAGCCGCCCCTCAAC
GGCCACCGCGGCGAGCACGTCGGCTACAGTGCCGCGGCGGCGGCGGCGGCGGCGGCGGCCGGCTACGACCGCAAG
CGCGCCTACGACCGCACCTACGACGCCATGGACGACTTCTTCGGCAACGCCAAGCGCCGCCAGATCGACCCCTCG
TCGTACGCCCAGATCGGCCGCTCGCTGCTCCCCCTGCACAACTCGCTGTCGGTGCCCAACGGCCAGATGACGGCC
CCGGAGCAGTACATGGCCCAGCCGGCCCCGGCCCCGGCCCCGGCCATGGTCCACTCGGGCCCCGCCCCGACGACG
AACCCGCTGACGCAGCAAAGGACCTGA
Transcript >Hirsu2|6034
ATGGCTTCACAGCTGCCCGACGGCTCGTCGGCCTCGAGCAACGGCAACGACTCCAAGTCCAACACGCCGGCGCCC
TCGAGCGCGACCTCGACCTCGTCCCAGCACAACGCCGACGACAACCTGACGTGCCGCTGGAACGCCTGCAACCAA
AAGTTCGGCAGCCCCGAGACGCTCTATGAGCACATCTGCGAGCGTCACGTCGGCCGCAAGAGCACCAACAACCTG
AACCTGACCTGCCAGTGGAACGCCTGCCGCACGACGACGGTCAAGCGCGACCACATCACCTCGCACATCCGCGTC
CATGTGCCGCTCAAGCCGCACAAGTGCGACTTTTGCGGAAAGTCGTTCAAGCGGCCTCAGGATCTCAAGAAGCAC
GTCAAGACCCACGCCGATGATTCCATGCTAGCCCGTCCGGGTCAGGACCACCAGGCAGGCCTCAACTACCGGGCG
CAAGCCAAAGGCCCCAGCTACTACGACCACAACGGCCAGATGCGCGGCGGCGTCGGCGGCTTCCCGCACCCGGCC
GGCCACAACGGCAGCTACTACGCCCCGCAGCCGTCGACCAACTATGCCCTCTACTTCAGCCAGCCGCCCCTCAAC
GGCCACCGCGGCGAGCACGTCGGCTACAGTGCCGCGGCGGCGGCGGCGGCGGCGGCGGCCGGCTACGACCGCAAG
CGCGCCTACGACCGCACCTACGACGCCATGGACGACTTCTTCGGCAACGCCAAGCGCCGCCAGATCGACCCCTCG
TCGTACGCCCAGATCGGCCGCTCGCTGCTCCCCCTGCACAACTCGCTGTCGGTGCCCAACGGCCAGATGACGGCC
CCGGAGCAGTACATGGCCCAGCCGGCCCCGGCCCCGGCCCCGGCCATGGTCCACTCGGGCCCCGCCCCGACGACG
AACCCGCTGACGCAGCAAAGGACCTGA
Gene >Hirsu2|6034
ATGGCTTCACAGCTGCCCGACGGCTCGTCGGCCTCGAGCAACGGCAACGACTCCAAGTCCAACACGCCGGCGCCC
TCGAGCGCGACCTCGACCTCGTCCCAGCACAACGCCGACGACAACCTGACGTGCCGCTGGAACGCCTGCAACCAA
AAGTTCGGCAGCCCCGAGACGCTCTATGTAAGCCGAGCCCGCCAGCCCCGGCATCGCCTGCCCCCCGACTCACCC
GGCCGCTGTAGGAGCACATCTGCGAGCGTCACGTCGGCCGCAAGAGCACCAACAACCTGAACCTGACCTGCCAGT
GGAACGCCTGCCGCACGACGACGGTCAAGCGCGACCACATCACCTCGCACATCCGCGTCCATGTGCCGCTCAAGC
CGCACAAGTGCGACTTTTGCGGAAAGTCGTTCAAGCGGCCTCAGGATCTCAAGAAGCACGTCAAGGTGAGAGACG
GACCGACGAAAGCCGCGCGCGTGGGAAGCCGCCTCTCTCACACATTCTGCCGCAGACCCACGCCGATGATTCCAT
GCTAGCCCGTCCGGGTCAGGACCACCAGGCAGGCCTCAACTACCGGGCGCAAGCCAAAGGTCAGCTCGCGCCCCC
TCCGTCCCCCTCCGCCCTGCCTCGAGAAAGGGGCTCGAGATGGCCTCGCGCCTGCTCGTCCCGGCGCAAGCGCTA
ACGGGACGCCCACCCGCAGGCCCCAGCTACTACGACCACAACGGCCAGATGCGCGGCGGCGTCGGCGGCTTCCCG
CACCCGGCCGGCCACAACGGCAGCTACTACGCCCCGCAGCCGTCGACCAACTATGCCCTCTACTTCAGCCAGCCG
CCCCTCAACGGCCACCGCGGCGAGCACGTCGGCTACAGTGCCGCGGCGGCGGCGGCGGCGGCGGCGGCCGGCTAC
GACCGCAAGCGCGCCTACGACCGCACCTACGACGCCATGGACGACTTCTTCGGCAACGCCAAGCGCCGCCAGATC
GACCCCTCGTCGTACGCCCAGATCGGCCGCTCGCTGCTCCCCCTGCACAACTCGCTGTCGGTGCCCAACGGCCAG
ATGACGGCCCCGGAGCAGTACATGGCCCAGCCGGCCCCGGCCCCGGCCCCGGCCATGGTCCACTCGGGCCCCGCC
CCGACGACGAACCCGCTGACGCAGCAGTACTACCTCCCGCACAGCATGCCCAACGCCCGGACGCAGAAGGACCTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail