Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6027
Gene name
LocationContig_304:16734..17172
Strand+
Gene length (bp)438
Transcript length (bp)438
Coding sequence length (bp)438
Protein length (aa) 146

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5079 0.4009 0.3426 0.0957 0.2534 0.0093 0.1883 0.0675 0.1377 0.0222

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6035
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1553
Ophiocordyceps australis 1348a (Ghana) OphauG2|2977
Ophiocordyceps subramaniannii Hirsu2|1376
Ophiocordyceps subramaniannii Hirsu2|2246
Ophiocordyceps subramaniannii Hirsu2|6027 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6027
MAKHVCNAMQSNPGNAHKALGRQFDKLLLKPLEDTIHHGRLEIMTVMIDALDECDGDQDVEAIIRLLSQMRHSEG
YPLKFFVTSRSEPPIRLGFASISGEYVESSLHGISESTTKRDIEVFLESRLKQIRTQFKMKSSWPDKSQL*
Coding >Hirsu2|6027
ATGGCCAAGCACGTGTGCAATGCAATGCAATCGAACCCCGGTAACGCCCACAAGGCCTTAGGACGTCAGTTTGAC
AAGTTACTCCTCAAACCGCTGGAGGACACCATCCATCATGGCCGTCTAGAGATCATGACGGTTATGATCGATGCA
CTTGACGAGTGCGATGGCGACCAGGACGTCGAGGCCATCATCCGCCTACTGTCGCAGATGCGTCACTCAGAAGGA
TATCCACTGAAGTTCTTCGTGACCAGCAGATCTGAGCCTCCCATCCGTCTTGGATTCGCGAGCATCTCTGGCGAG
TATGTCGAGTCCTCATTGCACGGAATTTCGGAGTCGACCACCAAGCGAGACATAGAAGTCTTCCTGGAATCCCGG
CTAAAGCAGATTCGAACGCAATTCAAGATGAAATCAAGCTGGCCTGACAAGTCTCAACTCTAG
Transcript >Hirsu2|6027
ATGGCCAAGCACGTGTGCAATGCAATGCAATCGAACCCCGGTAACGCCCACAAGGCCTTAGGACGTCAGTTTGAC
AAGTTACTCCTCAAACCGCTGGAGGACACCATCCATCATGGCCGTCTAGAGATCATGACGGTTATGATCGATGCA
CTTGACGAGTGCGATGGCGACCAGGACGTCGAGGCCATCATCCGCCTACTGTCGCAGATGCGTCACTCAGAAGGA
TATCCACTGAAGTTCTTCGTGACCAGCAGATCTGAGCCTCCCATCCGTCTTGGATTCGCGAGCATCTCTGGCGAG
TATGTCGAGTCCTCATTGCACGGAATTTCGGAGTCGACCACCAAGCGAGACATAGAAGTCTTCCTGGAATCCCGG
CTAAAGCAGATTCGAACGCAATTCAAGATGAAATCAAGCTGGCCTGACAAGTCTCAACTCTAG
Gene >Hirsu2|6027
ATGGCCAAGCACGTGTGCAATGCAATGCAATCGAACCCCGGTAACGCCCACAAGGCCTTAGGACGTCAGTTTGAC
AAGTTACTCCTCAAACCGCTGGAGGACACCATCCATCATGGCCGTCTAGAGATCATGACGGTTATGATCGATGCA
CTTGACGAGTGCGATGGCGACCAGGACGTCGAGGCCATCATCCGCCTACTGTCGCAGATGCGTCACTCAGAAGGA
TATCCACTGAAGTTCTTCGTGACCAGCAGATCTGAGCCTCCCATCCGTCTTGGATTCGCGAGCATCTCTGGCGAG
TATGTCGAGTCCTCATTGCACGGAATTTCGGAGTCGACCACCAAGCGAGACATAGAAGTCTTCCTGGAATCCCGG
CTAAAGCAGATTCGAACGCAATTCAAGATGAAATCAAGCTGGCCTGACAAGTCTCAACTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail