Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6025
Gene name
LocationContig_304:9356..10801
Strand+
Gene length (bp)1445
Transcript length (bp)1251
Coding sequence length (bp)1251
Protein length (aa) 417

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02917 Pertussis_S1 Pertussis toxin, subunit 1 3.3E-05 30 77

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0009405 pathogenesis Yes
GO:0003950 NAD+ ADP-ribosyltransferase activity Yes
GO:0005576 extracellular region Yes
GO:0008150 biological_process No
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0051704 multi-organism process No
GO:0016763 transferase activity, transferring pentosyl groups No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0044419 interspecies interaction between organisms No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6025
MGGPDPLYEAIPASKAVSKILQEVSQQSVFWRGDSRSPEVIFGSVFQASGSNMNLEDHLLSKGGSGYVSVSRARN
IAEAEKSSSKMGIDMRYVYIITPEKLPDGYWVPDVQWKGETPPLAKQEFEIAVPRAVPQKSIAGVYQGSRVGPQS
DATAFSETSLSEDLAVIPEENLQQDLALEAETVSEREFVELISAYIGNCQPEVEDVTGKCAREVPWNRVRRRGSV
APRRCDSIFREHGGSGPSGGDDGHCASDRLHYAADGGRGSGPGRLVGQLAVLSRGRLDPGRASTAPFGIVVHIVR
FIIKFKVTSRCRELLVLLPGMLRDSAAESLSVAADKYKNDFAEQLATTEMLERYSATTPWGLTEGDRINEFRVLA
QTLTTYLRSFPLPLPSNLELAHIIGHSKGLENAEFYRRRFT*
Coding >Hirsu2|6025
ATGGGGGGGCCAGATCCGCTGTACGAAGCTATTCCCGCCTCAAAAGCTGTCTCTAAGATTCTCCAAGAAGTCAGC
CAGCAGTCGGTTTTCTGGCGTGGCGATAGTCGGTCCCCTGAGGTGATATTTGGGTCCGTTTTTCAGGCGAGTGGA
AGTAACATGAACCTCGAGGATCATCTGCTCAGCAAAGGAGGTTCGGGGTATGTATCAGTTTCGCGGGCTCGCAAC
ATAGCCGAGGCCGAAAAGTCCAGCAGTAAGATGGGGATCGACATGCGTTATGTTTACATCATTACGCCAGAAAAA
CTACCAGACGGATACTGGGTCCCTGACGTACAGTGGAAGGGCGAAACCCCCCCGTTGGCAAAGCAGGAATTCGAG
ATCGCGGTGCCTCGTGCCGTTCCCCAGAAATCTATTGCGGGAGTCTACCAGGGCTCTCGAGTAGGCCCTCAGAGC
GATGCAACCGCTTTCTCCGAAACCTCTCTCTCCGAAGATTTGGCAGTAATTCCAGAGGAGAATCTGCAGCAAGAC
CTGGCACTCGAGGCCGAGACGGTGTCGGAGCGGGAGTTTGTGGAGCTCATTAGCGCGTACATCGGCAACTGCCAA
CCAGAGGTGGAAGATGTCACCGGAAAATGCGCGCGCGAAGTTCCTTGGAACCGCGTTCGTCGCCGTGGCTCTGTG
GCTCCCCGGCGTTGTGATAGCATTTTCCGAGAACACGGCGGCTCTGGACCAAGCGGCGGCGATGACGGCCATTGT
GCCTCTGATCGACTGCACTACGCAGCTGACGGCGGCCGTGGATCGGGACCAGGTCGACTCGTTGGACAGCTCGCT
GTGCTATCTCGGGGACGGCTTGATCCTGGGCGGGCCTCCACCGCTCCTTTCGGCATCGTGGTGCATATTGTGCGC
TTCATCATCAAGTTCAAAGTCACCAGCCGCTGTCGTGAGCTCCTGGTCCTTCTTCCGGGCATGCTCCGTGATAGC
GCAGCTGAGTCGCTATCGGTTGCAGCCGACAAATACAAGAACGACTTCGCCGAGCAACTGGCGACCACGGAGATG
CTCGAAAGATACTCAGCCACGACCCCATGGGGTTTGACTGAAGGCGACCGAATAAATGAGTTCAGGGTGCTCGCA
CAAACCCTGACAACCTATCTGCGTAGTTTCCCGCTCCCTTTGCCCAGCAACCTCGAACTCGCCCACATCATCGGA
CACTCCAAGGGCTTGGAAAACGCAGAGTTCTATCGTCGCAGGTTTACTTGA
Transcript >Hirsu2|6025
ATGGGGGGGCCAGATCCGCTGTACGAAGCTATTCCCGCCTCAAAAGCTGTCTCTAAGATTCTCCAAGAAGTCAGC
CAGCAGTCGGTTTTCTGGCGTGGCGATAGTCGGTCCCCTGAGGTGATATTTGGGTCCGTTTTTCAGGCGAGTGGA
AGTAACATGAACCTCGAGGATCATCTGCTCAGCAAAGGAGGTTCGGGGTATGTATCAGTTTCGCGGGCTCGCAAC
ATAGCCGAGGCCGAAAAGTCCAGCAGTAAGATGGGGATCGACATGCGTTATGTTTACATCATTACGCCAGAAAAA
CTACCAGACGGATACTGGGTCCCTGACGTACAGTGGAAGGGCGAAACCCCCCCGTTGGCAAAGCAGGAATTCGAG
ATCGCGGTGCCTCGTGCCGTTCCCCAGAAATCTATTGCGGGAGTCTACCAGGGCTCTCGAGTAGGCCCTCAGAGC
GATGCAACCGCTTTCTCCGAAACCTCTCTCTCCGAAGATTTGGCAGTAATTCCAGAGGAGAATCTGCAGCAAGAC
CTGGCACTCGAGGCCGAGACGGTGTCGGAGCGGGAGTTTGTGGAGCTCATTAGCGCGTACATCGGCAACTGCCAA
CCAGAGGTGGAAGATGTCACCGGAAAATGCGCGCGCGAAGTTCCTTGGAACCGCGTTCGTCGCCGTGGCTCTGTG
GCTCCCCGGCGTTGTGATAGCATTTTCCGAGAACACGGCGGCTCTGGACCAAGCGGCGGCGATGACGGCCATTGT
GCCTCTGATCGACTGCACTACGCAGCTGACGGCGGCCGTGGATCGGGACCAGGTCGACTCGTTGGACAGCTCGCT
GTGCTATCTCGGGGACGGCTTGATCCTGGGCGGGCCTCCACCGCTCCTTTCGGCATCGTGGTGCATATTGTGCGC
TTCATCATCAAGTTCAAAGTCACCAGCCGCTGTCGTGAGCTCCTGGTCCTTCTTCCGGGCATGCTCCGTGATAGC
GCAGCTGAGTCGCTATCGGTTGCAGCCGACAAATACAAGAACGACTTCGCCGAGCAACTGGCGACCACGGAGATG
CTCGAAAGATACTCAGCCACGACCCCATGGGGTTTGACTGAAGGCGACCGAATAAATGAGTTCAGGGTGCTCGCA
CAAACCCTGACAACCTATCTGCGTAGTTTCCCGCTCCCTTTGCCCAGCAACCTCGAACTCGCCCACATCATCGGA
CACTCCAAGGGCTTGGAAAACGCAGAGTTCTATCGTCGCAGGTTTACTTGA
Gene >Hirsu2|6025
ATGGGGGGGCCAGATCCGCTGTACGAAGCTATTCCCGCCTCAAAAGCTGTCTCTAAGATTCTCCAAGAAGTCAGC
CAGCAGTCGGTTTTCTGGCGTGGCGATAGTCGGTCCCCTGAGGTGATATTTGGGTCCGTTTTTCAGGCGAGTGGA
AGTAACATGAACCTCGAGGATCATCTGCTCAGCAAAGGAGGTTCGGGGTATGTATCAGTTTCGCGGGCTCGCAAC
ATAGCCGAGGCCGAAAAGTCCAGCAGTAAGATGGGGATCGACATGCGTTATGTTTACATCATTACGCCAGAAAAA
CTACCAGACGGATACTGGGTCCCTGACGTACAGTGGAAGGGCGAAACCCCCCCGTTGGCAAAGCAGGAATTCGAG
ATCGCGGTGCCTCGTGCCGTTCCCCAGAAATCTATTGCGGGAGTCTACCAGGGCTCTCGAGTAGGCCCTCAGAGC
GGTTGGATATGGAGGGAGAATCCGGGAGCAGCAAAAAGCTTGGCCGGGCTCTTCGATACCTCCTCTGGTGCTCGA
AAAGGAAAAGAGAGGTCTGCGGACTGACTCCGGATCTCGAAGATGCAACCGCTTTCTCCGAAACCTCTCTCTCCG
AAGATTTGGCAGTAATTCCAGAGGAGAATCTGCAGCAAGACCTGGCACTCGAGGCCGAGACGGTGTCGGAGCGGG
AGTTTGTGGAGCTCATTAGCGCGTACATCGGCAACTGCCAACCAGAGGTGGAAGATGTCACCGGAAAATGCGCGC
GCGAAGTTCCTTGGTTATAAGAAGCTCGAGCCCGGGTCACCTAAGCTCGCCCCAGGCACCCTGAGCAAGGGCACG
ACGCTACGGGTTGCAGGAACCGCGTTCGTCGCCGTGGCTCTGTGGCTCCCCGGCGTTGTGATAGCATTTTCCGAG
AACACGGCGGCTCTGGACCAAGCGGCGGCGATGACGGCCATTGTGCCTCTGATCGACTGCACTACGCAGCTGACG
GCGGCCGTGGATCGGGACCAGGTCGACTCGTTGGACAGCTCGCTGTGCTATCTCGGGGACGGCTTGATCCTGGGC
GGGCCTCCACCGCTCCTTTCGGCATCGTGGTGCATATTGTGCGCTTCATCATCAAGTTCAAAGTCACCAGCCGCT
GTCGTGAGCTCCTGGTCCTTCTTCCGGGCATGCTCCGTGATAGCGCAGCTGAGTCGCTATCGGTTGCAGCCGACA
AATACAAGAACGACTTCGCCGAGCAACTGGCGACCACGGAGATGCTCGAAAGATACTCAGCCACGACCCCATGGG
GTTTGACTGAAGGCGACCGAATAAATGAGTTCAGGGTGCTCGCACAAACCCTGACAACCTATCTGCGTAGTTTCC
CGCTCCCTTTGCCCAGCAACCTCGAACTCGCCCACATCATCGGACACTCCAAGGGCTTGGAAAACGCAGAGTTCT
ATCGTCGCAGGTTTACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail