Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6020
Gene name
LocationContig_3039:17..1281
Strand-
Gene length (bp)1264
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 8.8E-23 76 181
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 5.5E-15 78 315
PF12146 Hydrolase_4 Serine aminopeptidase, S33 9.7E-11 78 173
PF07819 PGAP1 PGAP1-like protein 1.1E-06 77 204
PF00975 Thioesterase Thioesterase domain 2.9E-08 77 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94437|YFI3_SCHPO Abhydrolase domain-containing protein C22H12.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22H12.03 PE=3 SV=1 76 325 1.0E-61
sp|P53219|IMO32_YEAST Abhydrolase domain-containing protein IMO32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMO32 PE=1 SV=1 50 323 1.0E-50
sp|Q0V9K2|ABHDB_XENTR Alpha/beta hydrolase domain-containing protein 11 OS=Xenopus tropicalis GN=abhd11 PE=2 SV=2 54 325 1.0E-43
sp|Q2TAP9|ABHDB_XENLA Alpha/beta hydrolase domain-containing protein 11 OS=Xenopus laevis GN=abhd11 PE=2 SV=1 19 325 2.0E-43
sp|Q3SZ73|ABHDB_BOVIN Alpha/beta hydrolase domain-containing protein 11 OS=Bos taurus GN=ABHD11 PE=2 SV=1 70 324 2.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94437|YFI3_SCHPO Abhydrolase domain-containing protein C22H12.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22H12.03 PE=3 SV=1 76 325 1.0E-61
sp|P53219|IMO32_YEAST Abhydrolase domain-containing protein IMO32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMO32 PE=1 SV=1 50 323 1.0E-50
sp|Q0V9K2|ABHDB_XENTR Alpha/beta hydrolase domain-containing protein 11 OS=Xenopus tropicalis GN=abhd11 PE=2 SV=2 54 325 1.0E-43
sp|Q2TAP9|ABHDB_XENLA Alpha/beta hydrolase domain-containing protein 11 OS=Xenopus laevis GN=abhd11 PE=2 SV=1 19 325 2.0E-43
sp|Q3SZ73|ABHDB_BOVIN Alpha/beta hydrolase domain-containing protein 11 OS=Bos taurus GN=ABHD11 PE=2 SV=1 70 324 2.0E-43
sp|Q8K4F5|ABHDB_MOUSE Alpha/beta hydrolase domain-containing protein 11 OS=Mus musculus GN=Abhd11 PE=1 SV=1 56 324 6.0E-41
sp|Q8NFV4|ABHDB_HUMAN Alpha/beta hydrolase domain-containing protein 11 OS=Homo sapiens GN=ABHD11 PE=1 SV=1 56 324 1.0E-39
sp|Q6DRD9|ABHDB_DANRE Alpha/beta hydrolase domain-containing protein 11 OS=Danio rerio GN=abhd11 PE=2 SV=1 57 323 1.0E-39
sp|P75736|YBFF_ECOLI Esterase YbfF OS=Escherichia coli (strain K12) GN=ybfF PE=1 SV=1 77 325 1.0E-24
sp|Q57427|Y193_HAEIN Putative esterase/lipase HI_0193 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0193 PE=3 SV=1 76 324 7.0E-24
sp|P53208|YG19_YEAST Uncharacterized abhydrolase domain-containing protein YGR015C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR015C PE=1 SV=1 76 326 2.0E-17
sp|P07383|TPES_PSEPU Tropinesterase OS=Pseudomonas putida PE=1 SV=1 77 323 3.0E-09
sp|P23974|MENH_BACSU Putative 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase OS=Bacillus subtilis (strain 168) GN=menH PE=3 SV=2 68 325 2.0E-08
sp|Q988D4|AAMHY_RHILO 2-(acetamidomethylene)succinate hydrolase OS=Rhizobium loti (strain MAFF303099) GN=mlr6787 PE=1 SV=1 76 325 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1676 0.1358 0.0455 0.1015 0.8948 0.083 0.0396 0.0646 0.0783 0.0512

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5441
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1298
Ophiocordyceps australis map64 (Brazil) OphauB2|5485
Ophiocordyceps camponoti-floridani Ophcf2|06060
Ophiocordyceps camponoti-rufipedis Ophun1|5799
Ophiocordyceps kimflemingae Ophio5|1376
Ophiocordyceps subramaniannii Hirsu2|6020 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6020
MILATGHQSNILLRPCSFWRVFQRLHLPRGFHRSVLRSLLFTRSISHLAPLDIVRPLAYDLYEPLDSAGNGGNRL
PPILFLHGLFGSRKNNRGISKALARDLRTRVYVLDLRNHGESPHNDHHDYCSMVEDVLTFVQDHGLDAVTLIGHS
MGAKVAMALALHRPDKVASLISVDNAPCHLPLNRDFVHYIRGMQQVQASNVVRQSDADRIMQEFEPSPSIRHFLL
GNLYRPEGEKIKRFRIPLDVLARSLGNLGGFPYTIPGETTFEKPTLFIRGTRSNYVCNRTLAVIGLFFPNYCLAE
VNAGHWLISEQPEAFRKAVNNFLTSKK*
Coding >Hirsu2|6020
ATGATATTGGCTACTGGTCATCAAAGTAATATCCTTTTACGGCCATGCTCCTTCTGGCGTGTATTTCAACGGCTG
CACCTCCCGCGAGGTTTCCACCGTTCAGTTCTCAGATCTCTCCTCTTTACCCGATCCATATCACACCTTGCCCCG
CTGGACATCGTTCGACCCTTGGCTTATGACCTGTACGAACCTCTCGACTCAGCGGGGAACGGTGGAAACCGCCTG
CCGCCCATTCTTTTTCTCCATGGCCTGTTCGGATCTAGGAAGAACAATCGGGGCATTAGCAAGGCACTCGCTCGC
GACCTGCGCACCCGTGTATATGTTCTTGACCTGAGAAATCACGGCGAATCCCCTCATAATGATCATCACGACTAT
TGCTCGATGGTTGAGGATGTATTGACTTTCGTACAAGACCACGGACTAGATGCCGTTACTCTTATCGGACATTCT
ATGGGAGCCAAAGTTGCCATGGCATTGGCATTACATCGGCCGGACAAGGTTGCCAGTCTGATTTCCGTGGACAAC
GCCCCTTGCCATCTTCCACTCAACCGGGACTTCGTACACTATATTCGTGGAATGCAACAGGTTCAGGCTTCGAAC
GTGGTCCGTCAATCCGACGCTGATCGAATCATGCAAGAGTTTGAACCGTCCCCATCGATTCGCCACTTTTTGCTT
GGAAATCTTTACCGACCTGAGGGTGAGAAGATCAAACGGTTTCGCATACCATTGGACGTTCTGGCTCGTTCTCTC
GGCAATCTCGGTGGATTTCCGTATACCATACCTGGCGAGACAACATTCGAAAAACCCACACTCTTTATTCGCGGC
ACTAGAAGTAACTACGTGTGCAATCGAACACTGGCAGTCATAGGGCTGTTTTTCCCAAACTACTGTCTCGCAGAG
GTCAATGCCGGACATTGGTTAATCTCGGAGCAACCTGAGGCGTTCCGAAAGGCCGTAAATAATTTCCTTACTAGT
AAGAAGTAA
Transcript >Hirsu2|6020
ATGATATTGGCTACTGGTCATCAAAGTAATATCCTTTTACGGCCATGCTCCTTCTGGCGTGTATTTCAACGGCTG
CACCTCCCGCGAGGTTTCCACCGTTCAGTTCTCAGATCTCTCCTCTTTACCCGATCCATATCACACCTTGCCCCG
CTGGACATCGTTCGACCCTTGGCTTATGACCTGTACGAACCTCTCGACTCAGCGGGGAACGGTGGAAACCGCCTG
CCGCCCATTCTTTTTCTCCATGGCCTGTTCGGATCTAGGAAGAACAATCGGGGCATTAGCAAGGCACTCGCTCGC
GACCTGCGCACCCGTGTATATGTTCTTGACCTGAGAAATCACGGCGAATCCCCTCATAATGATCATCACGACTAT
TGCTCGATGGTTGAGGATGTATTGACTTTCGTACAAGACCACGGACTAGATGCCGTTACTCTTATCGGACATTCT
ATGGGAGCCAAAGTTGCCATGGCATTGGCATTACATCGGCCGGACAAGGTTGCCAGTCTGATTTCCGTGGACAAC
GCCCCTTGCCATCTTCCACTCAACCGGGACTTCGTACACTATATTCGTGGAATGCAACAGGTTCAGGCTTCGAAC
GTGGTCCGTCAATCCGACGCTGATCGAATCATGCAAGAGTTTGAACCGTCCCCATCGATTCGCCACTTTTTGCTT
GGAAATCTTTACCGACCTGAGGGTGAGAAGATCAAACGGTTTCGCATACCATTGGACGTTCTGGCTCGTTCTCTC
GGCAATCTCGGTGGATTTCCGTATACCATACCTGGCGAGACAACATTCGAAAAACCCACACTCTTTATTCGCGGC
ACTAGAAGTAACTACGTGTGCAATCGAACACTGGCAGTCATAGGGCTGTTTTTCCCAAACTACTGTCTCGCAGAG
GTCAATGCCGGACATTGGTTAATCTCGGAGCAACCTGAGGCGTTCCGAAAGGCCGTAAATAATTTCCTTACTAGT
AAGAAGTAA
Gene >Hirsu2|6020
ATGATATTGGCTACTGGTCATCAAAGTAATATCCTTTTACGGCCATGCTCCTTCTGGCGTGTATTTCAACGGCTG
CACCTCCCGCGAGGTTTCCACCGTTCAGTTCTCAGATCTCTCCTCTTTACCCGATCCATATCACACCTTGCCCCG
CTGGACATCGTTCGACCCTTGGCTTATGACCTGTACGAACCTCTCGACTCAGCGGGGAACGGTGGAAACCGCCTG
CCGCCCATTCTTTTTCTCCATGGCCTGTTCGGATCTAGGAAGAACAATCGGGGCATTAGCAAGTATAGAACTGAG
GATACGTCCTGAAATATGTACGTGGCACAACGCTGAGCAGGGCTCAGGGCACTCGCTCGCGACCTGCGCACCCGT
GTATATGTTCTTGTAAGCTCACCGCCGCCATTGCGAAGCCTATACTTATTACTGCAGGACCTGAGAAATCACGGC
GAATCCCCTCATAATGATCATCACGACTATTGCTCGATGGTTGAGGATGTATTGACTTTCGTACAAGACCACGGA
CTAGATGCCGTTACTCTTATCGGACATTCTATGCATGTCATCCCGACTTAATGCAAAGGGCTTTCTCGGCTAATG
AACACTGGCAGGGGAGCCAAAGTTGCCATGGCATTGGCATTACATCGGCCGGACAAGGTTGCCAGTCTGATTTCC
GTGGACAACGCCCCTTGCCATCTTCCACTCAACCGGGACTTCGTACACTATATTCGTGGAATGCAACAGGTTCAG
GCTTCGAACGTGGTCCGTCAATCCGACGCTGATCGAATCATGCAAGAGTTTGAACCGGTATGCACACGTTTCTTG
ACCTAATAGACATTTATTTTGACTTACGCGCCGAGTTTCATCCTGTCCGTCTTAGTCCCCATCGATTCGCCACTT
TTTGCTTGGAAATCTTTACCGACCTGAGGGTGAGAAGATCAAACGGTTTCGCATACCATTGGACGTTCTGGCTCG
TTCTCTCGGCAATCTCGGTGGATTTCCGTATACCATACCTGGCGAGACAACATTCGAAAAACCCACACTCTTTAT
TCGCGGCACTAGAAGTAACTACGTGTGCAATCGAACACTGGCAGTCATAGGGCTGTTTTTCCCAAACTACTGTCT
CGCAGAGGTCAATGCCGGACATTGGTTAATCTCGGAGCAACCTGAGGCGTTCCGAAAGGGTAGGGAAAGCTCCTA
TCTCAATGCTTAAAATAGCTAACAAATCGTAGCCGTAAATAATTTCCTTACTAGTAAGAAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail