Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|601
Gene name
LocationContig_112:821..1809
Strand-
Gene length (bp)988
Transcript length (bp)585
Coding sequence length (bp)585
Protein length (aa) 195

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00857 Isochorismatase Isochorismatase family 3.0E-23 7 152

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08C33|ISOC1_DANRE Isochorismatase domain-containing protein 1 OS=Danio rerio GN=isoc1 PE=2 SV=1 9 175 2.0E-35
sp|Q0IHU5|ISOC1_XENTR Isochorismatase domain-containing protein 1 OS=Xenopus tropicalis GN=isoc1 PE=2 SV=1 9 177 6.0E-35
sp|Q5PQ71|ISOC2_XENLA Isochorismatase domain-containing protein 2 OS=Xenopus laevis GN=isoc2 PE=2 SV=1 4 174 7.0E-35
sp|B5X0W9|ISOC1_SALSA Isochorismatase domain-containing protein 1 OS=Salmo salar GN=isoc1 PE=2 SV=1 9 177 7.0E-35
sp|Q6DF67|ISOC2_XENTR Isochorismatase domain-containing protein 2 OS=Xenopus tropicalis GN=isoc2 PE=2 SV=1 4 174 3.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08C33|ISOC1_DANRE Isochorismatase domain-containing protein 1 OS=Danio rerio GN=isoc1 PE=2 SV=1 9 175 2.0E-35
sp|Q0IHU5|ISOC1_XENTR Isochorismatase domain-containing protein 1 OS=Xenopus tropicalis GN=isoc1 PE=2 SV=1 9 177 6.0E-35
sp|Q5PQ71|ISOC2_XENLA Isochorismatase domain-containing protein 2 OS=Xenopus laevis GN=isoc2 PE=2 SV=1 4 174 7.0E-35
sp|B5X0W9|ISOC1_SALSA Isochorismatase domain-containing protein 1 OS=Salmo salar GN=isoc1 PE=2 SV=1 9 177 7.0E-35
sp|Q6DF67|ISOC2_XENTR Isochorismatase domain-containing protein 2 OS=Xenopus tropicalis GN=isoc2 PE=2 SV=1 4 174 3.0E-34
sp|Q5PQA5|ISOC1_XENLA Isochorismatase domain-containing protein 1 OS=Xenopus laevis GN=isoc1 PE=2 SV=1 9 177 3.0E-34
sp|Q32KX0|ISOC2_BOVIN Isochorismatase domain-containing protein 2 OS=Bos taurus GN=ISOC2 PE=2 SV=1 8 175 4.0E-34
sp|A6QLY4|ISOC1_BOVIN Isochorismatase domain-containing protein 1 OS=Bos taurus GN=ISOC1 PE=2 SV=1 9 177 9.0E-34
sp|Q96CN7|ISOC1_HUMAN Isochorismatase domain-containing protein 1 OS=Homo sapiens GN=ISOC1 PE=1 SV=3 9 177 1.0E-33
sp|Q91V64|ISOC1_MOUSE Isochorismatase domain-containing protein 1 OS=Mus musculus GN=Isoc1 PE=1 SV=1 9 177 2.0E-33
sp|Q4R826|ISOC2_MACFA Isochorismatase domain-containing protein 2 OS=Macaca fascicularis GN=ISOC2 PE=2 SV=1 8 175 7.0E-33
sp|Q5RC03|ISOC2_PONAB Isochorismatase domain-containing protein 2 OS=Pongo abelii GN=ISOC2 PE=2 SV=1 8 175 8.0E-33
sp|Q96AB3|ISOC2_HUMAN Isochorismatase domain-containing protein 2 OS=Homo sapiens GN=ISOC2 PE=1 SV=1 8 175 2.0E-32
sp|Q6I7R3|ISOC1_RAT Isochorismatase domain-containing protein 1 OS=Rattus norvegicus GN=Isoc1 PE=1 SV=1 9 177 2.0E-32
sp|P85094|ISC2A_MOUSE Isochorismatase domain-containing protein 2A OS=Mus musculus GN=Isoc2a PE=1 SV=1 8 181 5.0E-31
sp|Q9DCC7|ISC2B_MOUSE Isochorismatase domain-containing protein 2B OS=Mus musculus GN=Isoc2b PE=1 SV=1 8 180 7.0E-31
sp|Q5U3Z3|ISOC2_RAT Isochorismatase domain-containing protein 2 OS=Rattus norvegicus GN=Isoc2 PE=2 SV=1 8 175 1.0E-30
sp|A0JME6|ISOC2_DANRE Isochorismatase domain-containing protein 2 OS=Danio rerio GN=isoc2 PE=2 SV=1 4 170 2.0E-30
sp|Q54NZ8|ISC1B_DICDI Isochorismatase family protein 1B OS=Dictyostelium discoideum GN=DDB_G0284901 PE=3 SV=1 7 180 5.0E-30
sp|Q54NZ6|ISC1A_DICDI Isochorismatase family protein 1A OS=Dictyostelium discoideum GN=DDB_G0285041 PE=3 SV=1 8 170 2.0E-25
sp|Q54RF0|ISC2A_DICDI Isochorismatase family protein 2A OS=Dictyostelium discoideum GN=DDB_G0283169 PE=3 SV=2 4 170 3.0E-21
sp|Q54RC7|ISC2B_DICDI Isochorismatase family protein 2B OS=Dictyostelium discoideum GN=DDB_G0283199 PE=3 SV=1 1 174 7.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|601
MRFKNPAIFVCDMQEKFRNAIYEFDSIVATATKLISFANGLSIPVYATTQTSSKLGPTVPALAKLLPGVPLDKTK
FSMLIPPLAAALPPASRIALVGIESHICITQTALDLRDAGHIPYVIADAVSSCNRPEVVIALDRLRAEPGIIVTT
SESWMYECLGDASHPSFKSLFGVVKGTLADTKRVLEALPPASKM*
Coding >Hirsu2|601
ATGCGGTTCAAGAACCCCGCCATCTTCGTCTGTGACATGCAGGAAAAGTTTCGCAACGCCATTTACGAGTTTGAC
AGCATAGTCGCTACAGCCACCAAGCTCATCTCCTTCGCCAACGGCCTGTCCATTCCCGTCTACGCCACCACGCAG
ACGTCGTCCAAGCTCGGCCCGACCGTTCCCGCCCTCGCCAAGCTCCTCCCCGGTGTTCCCCTGGACAAGACCAAG
TTTTCCATGCTCATCCCGCCTCTCGCCGCTGCCTTGCCTCCCGCCTCTCGCATCGCCCTCGTCGGCATCGAGTCG
CACATCTGCATCACCCAGACCGCTCTCGATCTGCGCGATGCCGGCCACATCCCCTATGTCATCGCCGACGCCGTC
AGCAGCTGCAATCGCCCCGAGGTCGTCATTGCCCTCGATCGCCTGCGCGCCGAGCCCGGCATCATCGTCACCACA
AGTGAGAGCTGGATGTACGAATGTCTCGGTGACGCTTCTCACCCATCCTTCAAGAGCCTCTTCGGCGTCGTCAAG
GGCACCCTGGCCGACACCAAGAGAGTCCTCGAGGCATTGCCGCCTGCCTCCAAGATGTGA
Transcript >Hirsu2|601
ATGCGGTTCAAGAACCCCGCCATCTTCGTCTGTGACATGCAGGAAAAGTTTCGCAACGCCATTTACGAGTTTGAC
AGCATAGTCGCTACAGCCACCAAGCTCATCTCCTTCGCCAACGGCCTGTCCATTCCCGTCTACGCCACCACGCAG
ACGTCGTCCAAGCTCGGCCCGACCGTTCCCGCCCTCGCCAAGCTCCTCCCCGGTGTTCCCCTGGACAAGACCAAG
TTTTCCATGCTCATCCCGCCTCTCGCCGCTGCCTTGCCTCCCGCCTCTCGCATCGCCCTCGTCGGCATCGAGTCG
CACATCTGCATCACCCAGACCGCTCTCGATCTGCGCGATGCCGGCCACATCCCCTATGTCATCGCCGACGCCGTC
AGCAGCTGCAATCGCCCCGAGGTCGTCATTGCCCTCGATCGCCTGCGCGCCGAGCCCGGCATCATCGTCACCACA
AGTGAGAGCTGGATGTACGAATGTCTCGGTGACGCTTCTCACCCATCCTTCAAGAGCCTCTTCGGCGTCGTCAAG
GGCACCCTGGCCGACACCAAGAGAGTCCTCGAGGCATTGCCGCCTGCCTCCAAGATGTGA
Gene >Hirsu2|601
ATGCGGTTCAGTACGTCCCCGTCCCTATCGCCGCCATTGTCTTCCTCAGACGAACCATGGTCCTTTGCTTCGCCC
CTCCGACTGACCGCAACGGCTCAGAGAACCCCGCCATCTTGTTGGTGAACCCCCTCTCCCCTCCTGTGGCCGGCG
GACGGGCCGAGTCTCGTCGTCGCAACGCCGCCATGATCGAGGCTGTCCACAAAACCTGTCGCTCGATACAGGGGG
GCCGAGTTGCTGACAGATCTTTCCGCTCTTTGATCGTGCCAGCGTCTGTGACATGCAGGAAAAGTTTCGCAACGC
CATTTACGAGTTTGACAGCATGTACGTTACTCCTGTCTCTTCTGACATCTGACCTCGGCCCCGACCATCACCTCT
CATCTCGCCCCCAAGAATATTGAGACAAGGGAAAAGGGAAAAAAATGACAGCAATAGTTGAGATCCGTCGCATGC
ACGTTGGCTGATGACTATCCCGGTTTTCTCCAGAGTCGCTACAGCCACCAAGCTCATCTCCTTCGCCAACGGCCT
GTCCATTCCCGTCTACGCCACCACGCAGACGTCGTCCAAGCTCGGCCCGACCGTTCCCGCCCTCGCCAAGCTCCT
CCCCGGTGTTCCCCTGGACAAGACCAAGTTTTCCATGCTCATCCCGCCTCTCGCCGCTGCCTTGCCTCCCGCCTC
TCGCATCGCCCTCGTCGGCATCGAGTCGCACATCTGCATCACCCAGACCGCTCTCGATCTGCGCGATGCCGGCCA
CATCCCCTATGTCATCGCCGACGCCGTCAGCAGCTGCAATCGCCCCGAGGTCGTCATTGCCCTCGATCGCCTGCG
CGCCGAGCCCGGCATCATCGTCACCACAAGTGAGAGCTGGATGTACGAATGTCTCGGTGACGCTTCTCACCCATC
CTTCAAGAGCCTCTTCGGCGTCGTCAAGGGCACCCTGGCCGACACCAAGAGAGTCCTCGAGGCATTGCCGCCTGC
CTCCAAGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail