Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6004
Gene name
LocationContig_3029:70..1346
Strand-
Gene length (bp)1276
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10309 NCBP3 Nuclear cap-binding protein subunit 3 8.6E-18 49 103

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74460|YCGG_SCHPO Uncharacterized protein C16C4.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC16C4.16c PE=4 SV=2 34 186 2.0E-07

GO

GO Term Description Terminal node
GO:0000340 RNA 7-methylguanosine cap binding Yes
GO:0003729 mRNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003723 RNA binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0000339 RNA cap binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6004
MGDARDIGAQMLFTFSADDILCSEETGEPGEVSEALSPKDGAGELKTVVPSKIYIRGLESLHTDDLEAYLRMHCG
AAYRIEWIDDTSANLVFGSDPTAREAIESLSSVAITNAKAIAVGELLPAKPFSGRPDISLHVRFALQSDKKRAGS
AIRSRYYLLHPEHDPGEKRRGRRDNRHYRDRGGDRRRDDAKRDGSGIYGTPTYEASMYDDVPQSTERRRYSDLEH
RSETYVRHNHGKELFRGRPALRDRSASPRRLDDGQEHEGILMTSRSNRLRARSITRRLSTINRAKELFPRRSSDR
SGQLSRLENCIGTASLREEDMPNIVTCPDTPPAGVFSIRGLASQRLDRQSDFVIKGQAKSAKELFPDKLGSKNVG
KELPEVGRQDPGKRPRTCFRKRGEDIL*
Coding >Hirsu2|6004
ATGGGCGATGCCCGCGATATTGGTGCACAAATGCTCTTTACTTTTTCAGCTGATGACATACTGTGTTCAGAAGAA
ACAGGCGAGCCTGGTGAAGTGAGCGAGGCCCTTTCGCCCAAAGATGGCGCGGGCGAGCTCAAAACAGTCGTCCCA
TCGAAAATTTACATTCGAGGGTTGGAATCTTTGCATACAGACGACCTAGAGGCTTATTTGAGGATGCACTGTGGC
GCCGCATATCGAATTGAATGGATAGACGACACATCTGCCAATCTTGTGTTTGGCTCGGACCCTACAGCCCGCGAG
GCTATTGAATCCCTGAGCTCGGTTGCCATAACCAACGCAAAAGCCATCGCCGTCGGGGAGCTCCTCCCCGCTAAG
CCGTTTAGTGGCAGGCCAGATATATCACTGCATGTGCGCTTTGCTCTCCAAAGTGATAAAAAGAGGGCTGGCTCC
GCAATTCGAAGTCGTTATTACCTTCTCCACCCCGAACATGATCCTGGGGAAAAGCGGCGTGGTCGTCGTGACAAT
CGCCACTACAGAGACAGAGGTGGGGACCGTCGCAGAGACGATGCGAAGAGAGACGGCTCGGGCATCTACGGGACC
CCGACGTACGAGGCGAGCATGTACGACGATGTACCACAGTCAACTGAGAGGAGGAGATACTCAGACCTGGAACAT
CGTTCAGAAACATATGTCCGTCACAATCACGGCAAAGAGCTGTTTAGGGGCCGACCGGCTTTGAGGGATCGATCG
GCCTCGCCGCGCCGACTTGATGACGGTCAGGAACATGAGGGTATCCTCATGACATCGCGGAGTAATAGACTCCGG
GCACGTTCCATAACACGTCGCCTCTCTACCATCAATCGTGCCAAGGAGCTGTTTCCCAGAAGGTCGTCAGACAGA
AGTGGGCAGCTAAGTCGGCTAGAAAACTGCATCGGCACTGCCAGCCTGCGCGAGGAAGACATGCCGAATATTGTG
ACATGCCCCGACACCCCGCCGGCCGGCGTGTTCAGCATTCGTGGCCTCGCAAGTCAGCGACTGGACCGCCAATCC
GATTTCGTTATCAAGGGACAAGCAAAAAGCGCAAAAGAGCTGTTTCCCGATAAGCTGGGTAGTAAAAATGTCGGG
AAAGAGTTGCCGGAAGTGGGCCGCCAAGACCCAGGCAAAAGGCCCAGGACCTGTTTCCGTAAACGAGGCGAGGAC
ATACTATGA
Transcript >Hirsu2|6004
ATGGGCGATGCCCGCGATATTGGTGCACAAATGCTCTTTACTTTTTCAGCTGATGACATACTGTGTTCAGAAGAA
ACAGGCGAGCCTGGTGAAGTGAGCGAGGCCCTTTCGCCCAAAGATGGCGCGGGCGAGCTCAAAACAGTCGTCCCA
TCGAAAATTTACATTCGAGGGTTGGAATCTTTGCATACAGACGACCTAGAGGCTTATTTGAGGATGCACTGTGGC
GCCGCATATCGAATTGAATGGATAGACGACACATCTGCCAATCTTGTGTTTGGCTCGGACCCTACAGCCCGCGAG
GCTATTGAATCCCTGAGCTCGGTTGCCATAACCAACGCAAAAGCCATCGCCGTCGGGGAGCTCCTCCCCGCTAAG
CCGTTTAGTGGCAGGCCAGATATATCACTGCATGTGCGCTTTGCTCTCCAAAGTGATAAAAAGAGGGCTGGCTCC
GCAATTCGAAGTCGTTATTACCTTCTCCACCCCGAACATGATCCTGGGGAAAAGCGGCGTGGTCGTCGTGACAAT
CGCCACTACAGAGACAGAGGTGGGGACCGTCGCAGAGACGATGCGAAGAGAGACGGCTCGGGCATCTACGGGACC
CCGACGTACGAGGCGAGCATGTACGACGATGTACCACAGTCAACTGAGAGGAGGAGATACTCAGACCTGGAACAT
CGTTCAGAAACATATGTCCGTCACAATCACGGCAAAGAGCTGTTTAGGGGCCGACCGGCTTTGAGGGATCGATCG
GCCTCGCCGCGCCGACTTGATGACGGTCAGGAACATGAGGGTATCCTCATGACATCGCGGAGTAATAGACTCCGG
GCACGTTCCATAACACGTCGCCTCTCTACCATCAATCGTGCCAAGGAGCTGTTTCCCAGAAGGTCGTCAGACAGA
AGTGGGCAGCTAAGTCGGCTAGAAAACTGCATCGGCACTGCCAGCCTGCGCGAGGAAGACATGCCGAATATTGTG
ACATGCCCCGACACCCCGCCGGCCGGCGTGTTCAGCATTCGTGGCCTCGCAAGTCAGCGACTGGACCGCCAATCC
GATTTCGTTATCAAGGGACAAGCAAAAAGCGCAAAAGAGCTGTTTCCCGATAAGCTGGGTAGTAAAAATGTCGGG
AAAGAGTTGCCGGAAGTGGGCCGCCAAGACCCAGGCAAAAGGCCCAGGACCTGTTTCCGTAAACGAGGCGAGGAC
ATACTATGA
Gene >Hirsu2|6004
ATGGGCGATGCCCGCGATATTGGTGCACAAATGCTCTTTACTTTTTCAGCTGATGACATACTGGTTAGTTAAGTC
CGTCCGTGGCGTTTTTTTTTTTTTGCTTTATTCTGACAAACGCCTTACCTCGCAGTGTTCAGAAGAAACAGGCGA
GCCTGGTGAAGTGAGCGAGGCCCTTTCGCCCAAAGATGGCGCGGGCGAGCTCAAAACAGTCGTCCCATCGAAAAT
TTACATTCGAGGGTTGGAATCTTTGCATACAGACGACCTAGAGGCTTATTTGAGGATGCACTGTGGCGCCGCATA
TCGAATTGAATGGATAGACGACACATCTGCCAATCTTGTGTTTGGCTCGGACCCTACAGCCCGCGAGGCTATTGA
ATCCCTGAGCTCGGTTGCCATAACCAACGCAAAAGCCATCGCCGTCGGGGAGCTCCTCCCCGCTAAGCCGTTTAG
TGGCAGGCCAGATATATCACTGCATGTGCGCTTTGCTCTCCAAAGTGATAAAAAGAGGGCTGGCTCCGCAATTCG
AAGTCGTTATTACCTTCTCCACCCCGAACATGATCCTGGGGAAAAGCGGCGTGGTCGTCGTGACAATCGCCACTA
CAGAGACAGAGGTGGGGACCGTCGCAGAGACGATGCGAAGAGAGACGGCTCGGGCATCTACGGGACCCCGACGTA
CGAGGCGAGCATGTACGACGATGTACCACAGTCAACTGAGAGGAGGAGATACTCAGACCTGGAACATCGTTCAGA
AACATATGTCCGTCACAATCACGGCAAAGAGCTGTTTAGGGGCCGACCGGCTTTGAGGGATCGATCGGCCTCGCC
GCGCCGACTTGATGACGGTCAGGAACATGAGGGTATCCTCATGACATCGCGGAGTAATAGACTCCGGGCACGTTC
CATAACACGTCGCCTCTCTACCATCAATCGTGCCAAGGAGCTGTTTCCCAGAAGGTCGTCAGACAGAAGTGGGCA
GCTAAGTCGGCTAGAAAACTGCATCGGCACTGCCAGCCTGCGCGAGGAAGACATGCCGAATATTGTGACATGCCC
CGACACCCCGCCGGCCGGCGTGTTCAGCATTCGTGGCCTCGCAAGTCAGCGACTGGACCGCCAATCCGATTTCGT
TATCAAGGGACAAGCAAAAAGCGCAAAAGAGCTGTTTCCCGATAAGCTGGGTAGTAAAAATGTCGGGAAAGAGTT
GCCGGAAGTGGGCCGCCAAGACCCAGGCAAAAGGCCCAGGACCTGTTTCCGTAAACGAGGCGAGGACATACTATG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail