Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6
Gene name
LocationContig_10:13321..14230
Strand+
Gene length (bp)909
Transcript length (bp)909
Coding sequence length (bp)909
Protein length (aa) 303

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P08658|LIP_PSEFR Lipase OS=Pseudomonas fragi PE=3 SV=2 70 220 9.0E-11
sp|Q05489|LIP_BURGL Lipase OS=Burkholderia glumae GN=lipA PE=1 SV=1 70 172 5.0E-07
sp|P22088|LIP_BURCE Lipase OS=Burkholderia cepacia GN=lipA PE=1 SV=2 70 172 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6
MLFRQLPLLAAVLSGLAGLATATPLPEEQQQQQDQGQGLQSAQEVQRAQEEAALGRSNDWSCRSSKHPNPVVLVH
ALFGSDKIGLNFLEGWLRKRGFCTFAPFYGSYVPFLPVLGGLKPIAQSSAEVADFVREVRRRTGAAKVDLVGHSE
GGFQSLYVPKFYPDVAAGVDRIVAIAPPTHGTTLLGLQRLLNLLGLVGCAACSDFTTDSPAVARLNDGRPIVQPG
NRLTVVASRLDEVVTPPSSSFVDEPAVQNIFVQDYCPIDLAGHLGENIDRNVWNLVLNALEDQHGRKFPCLGGPP
GR*
Coding >Hirsu2|6
ATGTTGTTCCGCCAGCTTCCGCTCCTGGCCGCCGTGCTGTCCGGCCTCGCCGGCCTCGCCACGGCAACGCCCCTC
CCCGAGGAGCAGCAGCAGCAGCAGGACCAGGGGCAGGGGCTGCAGAGCGCGCAGGAGGTGCAGAGGGCGCAGGAG
GAGGCGGCTCTGGGCCGGTCCAACGACTGGTCGTGCCGGAGCAGCAAGCACCCCAACCCCGTCGTCCTCGTGCAC
GCCCTCTTCGGCAGCGACAAGATCGGGCTCAACTTCCTCGAGGGCTGGCTCCGCAAGCGCGGCTTCTGCACCTTC
GCCCCCTTCTACGGCTCGTACGTGCCCTTCCTGCCGGTCCTGGGCGGCCTCAAGCCGATCGCGCAGTCGTCGGCC
GAGGTAGCCGACTTCGTGCGTGAGGTGCGTCGCCGCACCGGCGCCGCCAAGGTCGACCTCGTCGGCCACTCCGAG
GGCGGCTTCCAGTCGCTCTACGTGCCCAAGTTCTACCCGGACGTGGCGGCCGGCGTCGACCGCATCGTCGCCATC
GCGCCGCCCACCCACGGCACCACCCTGCTCGGCCTGCAGAGGCTGCTCAACCTGCTCGGCCTCGTCGGCTGCGCC
GCCTGCAGCGACTTCACCACCGACAGCCCCGCCGTCGCCCGCCTCAACGACGGCCGCCCCATCGTCCAGCCCGGC
AACCGCCTGACCGTCGTCGCCTCGCGCCTCGACGAGGTCGTCACCCCCCCCTCCAGCTCCTTCGTTGACGAGCCG
GCCGTCCAGAACATCTTCGTCCAGGACTACTGCCCCATCGACCTGGCCGGCCACCTCGGCGAGAACATCGACCGC
AACGTCTGGAACCTCGTCCTCAACGCCCTCGAGGACCAGCACGGCCGCAAGTTCCCCTGCCTGGGCGGGCCCCCC
GGCCGCTGA
Transcript >Hirsu2|6
ATGTTGTTCCGCCAGCTTCCGCTCCTGGCCGCCGTGCTGTCCGGCCTCGCCGGCCTCGCCACGGCAACGCCCCTC
CCCGAGGAGCAGCAGCAGCAGCAGGACCAGGGGCAGGGGCTGCAGAGCGCGCAGGAGGTGCAGAGGGCGCAGGAG
GAGGCGGCTCTGGGCCGGTCCAACGACTGGTCGTGCCGGAGCAGCAAGCACCCCAACCCCGTCGTCCTCGTGCAC
GCCCTCTTCGGCAGCGACAAGATCGGGCTCAACTTCCTCGAGGGCTGGCTCCGCAAGCGCGGCTTCTGCACCTTC
GCCCCCTTCTACGGCTCGTACGTGCCCTTCCTGCCGGTCCTGGGCGGCCTCAAGCCGATCGCGCAGTCGTCGGCC
GAGGTAGCCGACTTCGTGCGTGAGGTGCGTCGCCGCACCGGCGCCGCCAAGGTCGACCTCGTCGGCCACTCCGAG
GGCGGCTTCCAGTCGCTCTACGTGCCCAAGTTCTACCCGGACGTGGCGGCCGGCGTCGACCGCATCGTCGCCATC
GCGCCGCCCACCCACGGCACCACCCTGCTCGGCCTGCAGAGGCTGCTCAACCTGCTCGGCCTCGTCGGCTGCGCC
GCCTGCAGCGACTTCACCACCGACAGCCCCGCCGTCGCCCGCCTCAACGACGGCCGCCCCATCGTCCAGCCCGGC
AACCGCCTGACCGTCGTCGCCTCGCGCCTCGACGAGGTCGTCACCCCCCCCTCCAGCTCCTTCGTTGACGAGCCG
GCCGTCCAGAACATCTTCGTCCAGGACTACTGCCCCATCGACCTGGCCGGCCACCTCGGCGAGAACATCGACCGC
AACGTCTGGAACCTCGTCCTCAACGCCCTCGAGGACCAGCACGGCCGCAAGTTCCCCTGCCTGGGCGGGCCCCCC
GGCCGCTGA
Gene >Hirsu2|6
ATGTTGTTCCGCCAGCTTCCGCTCCTGGCCGCCGTGCTGTCCGGCCTCGCCGGCCTCGCCACGGCAACGCCCCTC
CCCGAGGAGCAGCAGCAGCAGCAGGACCAGGGGCAGGGGCTGCAGAGCGCGCAGGAGGTGCAGAGGGCGCAGGAG
GAGGCGGCTCTGGGCCGGTCCAACGACTGGTCGTGCCGGAGCAGCAAGCACCCCAACCCCGTCGTCCTCGTGCAC
GCCCTCTTCGGCAGCGACAAGATCGGGCTCAACTTCCTCGAGGGCTGGCTCCGCAAGCGCGGCTTCTGCACCTTC
GCCCCCTTCTACGGCTCGTACGTGCCCTTCCTGCCGGTCCTGGGCGGCCTCAAGCCGATCGCGCAGTCGTCGGCC
GAGGTAGCCGACTTCGTGCGTGAGGTGCGTCGCCGCACCGGCGCCGCCAAGGTCGACCTCGTCGGCCACTCCGAG
GGCGGCTTCCAGTCGCTCTACGTGCCCAAGTTCTACCCGGACGTGGCGGCCGGCGTCGACCGCATCGTCGCCATC
GCGCCGCCCACCCACGGCACCACCCTGCTCGGCCTGCAGAGGCTGCTCAACCTGCTCGGCCTCGTCGGCTGCGCC
GCCTGCAGCGACTTCACCACCGACAGCCCCGCCGTCGCCCGCCTCAACGACGGCCGCCCCATCGTCCAGCCCGGC
AACCGCCTGACCGTCGTCGCCTCGCGCCTCGACGAGGTCGTCACCCCCCCCTCCAGCTCCTTCGTTGACGAGCCG
GCCGTCCAGAACATCTTCGTCCAGGACTACTGCCCCATCGACCTGGCCGGCCACCTCGGCGAGAACATCGACCGC
AACGTCTGGAACCTCGTCCTCAACGCCCTCGAGGACCAGCACGGCCGCAAGTTCCCCTGCCTGGGCGGGCCCCCC
GGCCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail