Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5998
Gene name
LocationContig_302:22458..24030
Strand+
Gene length (bp)1572
Transcript length (bp)1509
Coding sequence length (bp)1509
Protein length (aa) 503

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11931 DUF3449 Domain of unknown function (DUF3449) 9.0E-78 314 501
PF16837 SF3A3 Pre-mRNA-splicing factor SF3A3, of SF3a complex, Prp9 1.8E-24 125 204
PF12108 SF3a60_bindingd Splicing factor SF3a60 binding domain 5.9E-12 73 99
PF12874 zf-met Zinc-finger of C2H2 type 7.2E-06 247 270
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 6.0E-07 247 270

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59706|SAP61_SCHPO Pre-mRNA-splicing factor sap61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap61 PE=1 SV=1 3 502 5.0E-124
sp|O46106|NOI_DROME Splicing factor 3A subunit 3 OS=Drosophila melanogaster GN=noi PE=1 SV=1 3 502 1.0E-69
sp|P19736|PRP9_YEAST Pre-mRNA-splicing factor PRP9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP9 PE=1 SV=1 38 502 7.0E-46
sp|Q9D554|SF3A3_MOUSE Splicing factor 3A subunit 3 OS=Mus musculus GN=Sf3a3 PE=1 SV=2 379 502 2.0E-40
sp|Q12874|SF3A3_HUMAN Splicing factor 3A subunit 3 OS=Homo sapiens GN=SF3A3 PE=1 SV=1 379 502 2.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59706|SAP61_SCHPO Pre-mRNA-splicing factor sap61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap61 PE=1 SV=1 3 502 5.0E-124
sp|O46106|NOI_DROME Splicing factor 3A subunit 3 OS=Drosophila melanogaster GN=noi PE=1 SV=1 3 502 1.0E-69
sp|P19736|PRP9_YEAST Pre-mRNA-splicing factor PRP9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP9 PE=1 SV=1 38 502 7.0E-46
sp|Q9D554|SF3A3_MOUSE Splicing factor 3A subunit 3 OS=Mus musculus GN=Sf3a3 PE=1 SV=2 379 502 2.0E-40
sp|Q12874|SF3A3_HUMAN Splicing factor 3A subunit 3 OS=Homo sapiens GN=SF3A3 PE=1 SV=1 379 502 2.0E-40
sp|Q9D554|SF3A3_MOUSE Splicing factor 3A subunit 3 OS=Mus musculus GN=Sf3a3 PE=1 SV=2 3 236 1.0E-26
sp|Q12874|SF3A3_HUMAN Splicing factor 3A subunit 3 OS=Homo sapiens GN=SF3A3 PE=1 SV=1 3 236 2.0E-26
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5998
MLVAEDQRYIHEDLERLEQAIADRAREEHKHIRNQLNQGHEIAQLLEQIQQQCSNLVAIFEDDAGSMAREIEQIE
TGDPFGQFYSQLNELREHHSRYPNEQAENSEQRYKARRVADMPTIVDSIFSGEEAYGRFFDLHTCHEAFMNLPNV
KRLNYLQYLENFDNFSPGYGGVKRVEKLTDQYFKYVGDIVDYLVSFRKRTQPLEPSGMVLAKLDEEFDKAWDNDE
LQGWQLDQTSGKKDSDGAGTVWCAECEKEFKNENVYKGHLAGRKHLKAAEHRKQLQQEQKEVGGDEKAERRGNQV
SMTRVKERAVAKREFYVKRLAEGMSVVRSDTRVNVERRQGMTERERQQELENLQNMSDAPRGGAEEDEEEDEDGE
EKIYNPLKLPLAWDGKPIPFWLYRLHGLGVEFHCEICGNFVYMGRRAFDKHFGEPRHIHGLKCLGITNVTLFRDI
TKIEEALKLWEKLQQEQKRSKVDEGSIVQMEDGEGNVMPEKVYLDLQKQGLL*
Coding >Hirsu2|5998
ATGCTTGTCGCCGAAGACCAACGATACATCCACGAGGATCTGGAGCGCCTGGAGCAGGCCATCGCGGATCGTGCT
CGTGAGGAGCACAAACATATTCGCAACCAATTGAACCAAGGGCACGAGATAGCCCAGCTCCTGGAGCAGATTCAG
CAGCAGTGCAGCAACCTCGTCGCCATCTTCGAGGACGATGCGGGGTCGATGGCTCGCGAGATCGAGCAGATCGAA
ACGGGTGATCCGTTTGGCCAGTTCTACAGCCAGCTCAACGAACTGCGTGAACACCATTCTCGGTACCCAAACGAG
CAGGCTGAGAACTCGGAGCAACGCTACAAGGCGAGACGCGTGGCCGACATGCCTACCATTGTCGACAGCATTTTC
TCGGGCGAAGAAGCATACGGTCGTTTCTTCGATCTCCATACCTGCCATGAGGCGTTTATGAACCTTCCCAATGTC
AAGCGACTCAACTACCTGCAGTATCTCGAGAACTTTGACAACTTTTCGCCCGGGTATGGAGGCGTCAAACGGGTC
GAGAAACTCACAGATCAGTACTTCAAGTACGTCGGCGACATTGTCGACTATCTCGTGTCTTTCCGGAAGCGGACC
CAGCCGTTGGAGCCCAGTGGCATGGTCTTGGCCAAACTCGACGAGGAGTTTGACAAGGCCTGGGACAACGACGAG
CTCCAAGGCTGGCAGCTGGACCAGACATCGGGAAAGAAGGACTCGGACGGCGCCGGGACGGTTTGGTGCGCCGAG
TGCGAAAAAGAATTCAAAAACGAGAACGTCTACAAGGGCCACCTGGCTGGGAGGAAGCATCTCAAAGCCGCCGAG
CACCGGAAGCAACTGCAGCAGGAGCAGAAGGAAGTGGGCGGTGACGAGAAAGCTGAACGCAGAGGGAATCAGGTC
TCGATGACGCGAGTCAAGGAGCGGGCGGTAGCCAAGCGCGAATTCTACGTCAAGAGACTTGCCGAGGGCATGAGC
GTTGTACGAAGCGACACGCGCGTCAACGTGGAGCGGAGGCAAGGGATGACGGAGCGCGAGCGACAGCAGGAGCTC
GAAAACCTGCAGAACATGTCCGATGCCCCTCGAGGAGGCGCCGAGGAGGACGAGGAGGAGGACGAAGACGGCGAA
GAAAAGATTTACAACCCGCTGAAGCTGCCGCTGGCCTGGGACGGCAAGCCGATCCCGTTCTGGCTGTACCGACTT
CACGGCCTCGGCGTCGAGTTCCACTGCGAGATCTGCGGCAACTTCGTCTACATGGGCCGGCGGGCCTTCGATAAG
CACTTTGGCGAGCCGCGCCACATCCACGGCCTGAAGTGCCTGGGCATCACCAACGTGACCCTCTTCAGGGACATC
ACCAAGATCGAGGAGGCGCTGAAGCTCTGGGAGAAGCTCCAGCAGGAGCAGAAGAGGTCCAAGGTGGACGAAGGG
AGCATCGTGCAGATGGAGGATGGCGAGGGCAACGTCATGCCGGAGAAGGTGTACCTGGATCTGCAGAAACAGGGC
CTGCTGTGA
Transcript >Hirsu2|5998
ATGCTTGTCGCCGAAGACCAACGATACATCCACGAGGATCTGGAGCGCCTGGAGCAGGCCATCGCGGATCGTGCT
CGTGAGGAGCACAAACATATTCGCAACCAATTGAACCAAGGGCACGAGATAGCCCAGCTCCTGGAGCAGATTCAG
CAGCAGTGCAGCAACCTCGTCGCCATCTTCGAGGACGATGCGGGGTCGATGGCTCGCGAGATCGAGCAGATCGAA
ACGGGTGATCCGTTTGGCCAGTTCTACAGCCAGCTCAACGAACTGCGTGAACACCATTCTCGGTACCCAAACGAG
CAGGCTGAGAACTCGGAGCAACGCTACAAGGCGAGACGCGTGGCCGACATGCCTACCATTGTCGACAGCATTTTC
TCGGGCGAAGAAGCATACGGTCGTTTCTTCGATCTCCATACCTGCCATGAGGCGTTTATGAACCTTCCCAATGTC
AAGCGACTCAACTACCTGCAGTATCTCGAGAACTTTGACAACTTTTCGCCCGGGTATGGAGGCGTCAAACGGGTC
GAGAAACTCACAGATCAGTACTTCAAGTACGTCGGCGACATTGTCGACTATCTCGTGTCTTTCCGGAAGCGGACC
CAGCCGTTGGAGCCCAGTGGCATGGTCTTGGCCAAACTCGACGAGGAGTTTGACAAGGCCTGGGACAACGACGAG
CTCCAAGGCTGGCAGCTGGACCAGACATCGGGAAAGAAGGACTCGGACGGCGCCGGGACGGTTTGGTGCGCCGAG
TGCGAAAAAGAATTCAAAAACGAGAACGTCTACAAGGGCCACCTGGCTGGGAGGAAGCATCTCAAAGCCGCCGAG
CACCGGAAGCAACTGCAGCAGGAGCAGAAGGAAGTGGGCGGTGACGAGAAAGCTGAACGCAGAGGGAATCAGGTC
TCGATGACGCGAGTCAAGGAGCGGGCGGTAGCCAAGCGCGAATTCTACGTCAAGAGACTTGCCGAGGGCATGAGC
GTTGTACGAAGCGACACGCGCGTCAACGTGGAGCGGAGGCAAGGGATGACGGAGCGCGAGCGACAGCAGGAGCTC
GAAAACCTGCAGAACATGTCCGATGCCCCTCGAGGAGGCGCCGAGGAGGACGAGGAGGAGGACGAAGACGGCGAA
GAAAAGATTTACAACCCGCTGAAGCTGCCGCTGGCCTGGGACGGCAAGCCGATCCCGTTCTGGCTGTACCGACTT
CACGGCCTCGGCGTCGAGTTCCACTGCGAGATCTGCGGCAACTTCGTCTACATGGGCCGGCGGGCCTTCGATAAG
CACTTTGGCGAGCCGCGCCACATCCACGGCCTGAAGTGCCTGGGCATCACCAACGTGACCCTCTTCAGGGACATC
ACCAAGATCGAGGAGGCGCTGAAGCTCTGGGAGAAGCTCCAGCAGGAGCAGAAGAGGTCCAAGGTGGACGAAGGG
AGCATCGTGCAGATGGAGGATGGCGAGGGCAACGTCATGCCGGAGAAGGTGTACCTGGATCTGCAGAAACAGGGC
CTGCTGTGA
Gene >Hirsu2|5998
ATGCTTGTCGCCGAAGACCAACGATACATCCACGAGGATCTGGAGCGCCTGGAGCAGGCCATCGCGGATCGTGCT
CGTGAGGAGCACAAACATGTGAGTATCTTGCAGCCCTCTGACCTCACCGCAGCCTCGGACGCTGAAACTTGGAGA
CGCGAGATTCGCAACCAATTGAACCAAGGGCACGAGATAGCCCAGCTCCTGGAGCAGATTCAGCAGCAGTGCAGC
AACCTCGTCGCCATCTTCGAGGACGATGCGGGGTCGATGGCTCGCGAGATCGAGCAGATCGAAACGGGTGATCCG
TTTGGCCAGTTCTACAGCCAGCTCAACGAACTGCGTGAACACCATTCTCGGTACCCAAACGAGCAGGCTGAGAAC
TCGGAGCAACGCTACAAGGCGAGACGCGTGGCCGACATGCCTACCATTGTCGACAGCATTTTCTCGGGCGAAGAA
GCATACGGTCGTTTCTTCGATCTCCATACCTGCCATGAGGCGTTTATGAACCTTCCCAATGTCAAGCGACTCAAC
TACCTGCAGTATCTCGAGAACTTTGACAACTTTTCGCCCGGGTATGGAGGCGTCAAACGGGTCGAGAAACTCACA
GATCAGTACTTCAAGTACGTCGGCGACATTGTCGACTATCTCGTGTCTTTCCGGAAGCGGACCCAGCCGTTGGAG
CCCAGTGGCATGGTCTTGGCCAAACTCGACGAGGAGTTTGACAAGGCCTGGGACAACGACGAGCTCCAAGGCTGG
CAGCTGGACCAGACATCGGGAAAGAAGGACTCGGACGGCGCCGGGACGGTTTGGTGCGCCGAGTGCGAAAAAGAA
TTCAAAAACGAGAACGTCTACAAGGGCCACCTGGCTGGGAGGAAGCATCTCAAAGCCGCCGAGCACCGGAAGCAA
CTGCAGCAGGAGCAGAAGGAAGTGGGCGGTGACGAGAAAGCTGAACGCAGAGGGAATCAGGTCTCGATGACGCGA
GTCAAGGAGCGGGCGGTAGCCAAGCGCGAATTCTACGTCAAGAGACTTGCCGAGGGCATGAGCGTTGTACGAAGC
GACACGCGCGTCAACGTGGAGCGGAGGCAAGGGATGACGGAGCGCGAGCGACAGCAGGAGCTCGAAAACCTGCAG
AACATGTCCGATGCCCCTCGAGGAGGCGCCGAGGAGGACGAGGAGGAGGACGAAGACGGCGAAGAAAAGATTTAC
AACCCGCTGAAGCTGCCGCTGGCCTGGGACGGCAAGCCGATCCCGTTCTGGCTGTACCGACTTCACGGCCTCGGC
GTCGAGTTCCACTGCGAGATCTGCGGCAACTTCGTCTACATGGGCCGGCGGGCCTTCGATAAGCACTTTGGCGAG
CCGCGCCACATCCACGGCCTGAAGTGCCTGGGCATCACCAACGTGACCCTCTTCAGGGACATCACCAAGATCGAG
GAGGCGCTGAAGCTCTGGGAGAAGCTCCAGCAGGAGCAGAAGAGGTCCAAGGTGGACGAAGGGAGCATCGTGCAG
ATGGAGGATGGCGAGGGCAACGTCATGCCGGAGAAGGTGTACCTGGATCTGCAGAAACAGGGCCTGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail