Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5989
Gene name
LocationContig_302:2519..3949
Strand-
Gene length (bp)1430
Transcript length (bp)1299
Coding sequence length (bp)1299
Protein length (aa) 433

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05208 ALG3 ALG3 protein 1.5E-144 33 396

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C1K8|ALG3_NEUCR Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-3 PE=3 SV=1 2 429 0.0E+00
sp|Q2U6A4|ALG3_ASPOR Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=alg3 PE=3 SV=1 14 429 4.0E-148
sp|A1DDZ3|ALG3_NEOFI Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=alg3 PE=3 SV=1 14 432 1.0E-137
sp|Q4WVG2|ALG3_ASPFU Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alg3 PE=3 SV=1 14 432 4.0E-136
sp|A1CBE6|ALG3_ASPCL Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=alg3 PE=3 SV=1 14 407 4.0E-128
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C1K8|ALG3_NEUCR Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-3 PE=3 SV=1 2 429 0.0E+00
sp|Q2U6A4|ALG3_ASPOR Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=alg3 PE=3 SV=1 14 429 4.0E-148
sp|A1DDZ3|ALG3_NEOFI Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=alg3 PE=3 SV=1 14 432 1.0E-137
sp|Q4WVG2|ALG3_ASPFU Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alg3 PE=3 SV=1 14 432 4.0E-136
sp|A1CBE6|ALG3_ASPCL Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=alg3 PE=3 SV=1 14 407 4.0E-128
sp|A2RA94|ALG3_ASPNC Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=alg3 PE=3 SV=1 16 403 4.0E-113
sp|Q0TVF9|ALG3_PHANO Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ALG3 PE=3 SV=2 16 317 1.0E-99
sp|Q9Y7I4|ALG3_SCHPO Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg3 PE=3 SV=1 29 411 1.0E-87
sp|Q55F69|ALG3_DICDI Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Dictyostelium discoideum GN=alg3 PE=3 SV=1 23 428 8.0E-81
sp|P0CN92|ALG3_CRYNJ Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ALG3 PE=3 SV=1 34 413 2.0E-80
sp|P0CN93|ALG3_CRYNB Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ALG3 PE=3 SV=1 34 413 2.0E-80
sp|O82244|ALG3_ARATH Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Arabidopsis thaliana GN=ALG3 PE=1 SV=1 32 396 1.0E-78
sp|Q92685|ALG3_HUMAN Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Homo sapiens GN=ALG3 PE=1 SV=1 29 399 4.0E-77
sp|Q8K2A8|ALG3_MOUSE Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Mus musculus GN=Alg3 PE=1 SV=2 29 396 5.0E-76
sp|Q6CMF1|ALG3_KLULA Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG3 PE=3 SV=1 48 428 2.0E-73
sp|A3LTB7|ALG3_PICST Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ALG3 PE=3 SV=2 3 403 1.0E-69
sp|Q6BYY8|ALG3_DEBHA Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG3 PE=3 SV=1 3 432 3.0E-67
sp|Q751K5|ALG3_ASHGO Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG3 PE=3 SV=2 38 396 5.0E-67
sp|P38179|ALG3_YEAST Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG3 PE=1 SV=1 34 396 1.0E-64
sp|Q6FXS2|ALG3_CANGA Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG3 PE=3 SV=1 34 425 1.0E-63
sp|Q6DNA2|ALG3_PICPG Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ALG3 PE=3 SV=2 3 396 2.0E-63
sp|A5DJQ5|ALG3_PICGU Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ALG3 PE=3 SV=2 3 411 2.0E-59
sp|Q24332|NT56_DROVI Lethal(2)neighbour of Tid protein OS=Drosophila virilis GN=l(2)not PE=1 SV=1 12 292 9.0E-57
sp|P82149|NT53_DROME Lethal(2)neighbour of tid protein 2 OS=Drosophila melanogaster GN=l(2)not2 PE=2 SV=1 29 396 2.0E-55
sp|Q27333|NT56_DROME Lethal(2)neighbour of tid protein OS=Drosophila melanogaster GN=l(2)not PE=1 SV=1 29 275 1.0E-47
[Show less]

GO

GO Term Description Terminal node
GO:0030176 integral component of endoplasmic reticulum membrane Yes
GO:0000030 mannosyltransferase activity Yes
GO:0044446 intracellular organelle part No
GO:0005575 cellular_component No
GO:0044432 endoplasmic reticulum part No
GO:0031224 intrinsic component of membrane No
GO:0031227 intrinsic component of endoplasmic reticulum membrane No
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0044422 organelle part No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0016740 transferase activity No
GO:0016758 transferase activity, transferring hexosyl groups No
GO:0003674 molecular_function No
GO:0044424 intracellular part No
GO:0016021 integral component of membrane No
GO:0044425 membrane part No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 106 128 22
3 150 172 22
4 185 207 22
5 266 288 22
6 353 375 22
7 395 417 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5989
MPPPLPPAALRTWHFVRDVACGRHALSSLVPLALWLVDAALCCLIIWRVPYTEIDWTAYMEQVAQFVSGERDYTK
MEGGTGPLVYPAAHLYTYTGLYYLTDQGKDIFLAQQLFAVLYMATLALVMLCYRQAEAPPYILPLLILSKRLHSI
FVLRCFNDCFAVFFLWLAIFFFQRRSWTFGALAYSWGLGVKMSLLLVLPAVGLVLFLGRGFGGSLRLASLMAQLQ
LLIALPFLQTNWKGYLGRAFELSRQFKYEWTVNWRMLGEHLFLSRSLALALLALHALVLLIFVATRWMRPADRPL
SALMPAMLRGQSPFALREEVRVSGRVTPEYVMTTVLSANVIGLLFARSLHYQFYAYLAWATPYLLWVAAPHPILV
PLLWLTQEWAWNVFPSTDASSVVVVNALLITVGLVYFGTPGVDDLPTRRKAAERKSE*
Coding >Hirsu2|5989
ATGCCGCCGCCTCTGCCGCCCGCGGCACTGCGTACGTGGCACTTCGTCCGCGACGTCGCCTGTGGCCGGCATGCG
CTGTCGAGCCTCGTCCCTCTCGCACTCTGGCTCGTCGATGCCGCCCTGTGCTGTCTGATTATCTGGAGGGTCCCC
TACACCGAGATCGACTGGACCGCGTACATGGAGCAGGTGGCGCAGTTCGTCTCCGGCGAGCGCGACTACACCAAG
ATGGAGGGAGGCACGGGTCCGCTCGTCTACCCGGCCGCGCACCTCTACACCTACACCGGGCTCTACTACCTGACG
GACCAGGGCAAGGACATCTTTCTCGCGCAGCAGCTCTTCGCCGTTCTCTACATGGCGACGCTCGCGCTGGTAATG
CTGTGCTATCGCCAGGCCGAGGCTCCGCCGTACATCCTGCCTCTCCTGATCCTGTCCAAGCGCCTCCACAGCATC
TTCGTCCTGCGCTGCTTCAACGACTGCTTCGCCGTCTTCTTCCTGTGGCTCGCCATCTTCTTTTTCCAGCGCCGG
TCCTGGACCTTTGGCGCCCTGGCCTACAGCTGGGGACTCGGCGTCAAGATGTCCCTGCTGCTGGTTCTCCCGGCC
GTCGGCCTCGTGCTCTTCCTGGGGCGCGGTTTCGGGGGGAGCCTGCGGCTGGCCTCGCTCATGGCGCAGCTGCAG
CTGCTCATCGCCCTCCCCTTCCTCCAGACCAACTGGAAGGGCTACCTGGGACGGGCGTTTGAGCTTTCGCGGCAG
TTCAAGTACGAGTGGACGGTCAATTGGCGGATGCTAGGCGAGCACCTCTTCCTCAGCAGGTCCTTGGCCCTGGCG
CTGCTCGCCCTGCATGCCCTGGTGCTCCTCATCTTCGTCGCGACGAGGTGGATGCGACCCGCGGACCGACCCCTG
TCCGCCCTGATGCCAGCCATGCTGCGCGGACAATCGCCCTTTGCGCTGCGAGAAGAGGTCCGGGTGTCCGGCCGA
GTCACGCCGGAGTACGTCATGACGACCGTCCTCTCCGCCAACGTCATCGGGCTGCTGTTCGCTCGGTCCCTCCAC
TACCAGTTCTACGCCTATCTCGCCTGGGCGACGCCGTACCTGCTGTGGGTGGCCGCGCCGCACCCGATCCTCGTG
CCCCTGCTCTGGCTGACGCAAGAATGGGCCTGGAACGTCTTCCCGAGCACCGACGCGAGCTCCGTCGTCGTCGTC
AACGCCCTGTTGATCACCGTCGGCTTGGTCTACTTCGGCACGCCGGGGGTCGACGATTTGCCCACGCGGCGGAAG
GCGGCGGAGAGGAAGAGCGAGTGA
Transcript >Hirsu2|5989
ATGCCGCCGCCTCTGCCGCCCGCGGCACTGCGTACGTGGCACTTCGTCCGCGACGTCGCCTGTGGCCGGCATGCG
CTGTCGAGCCTCGTCCCTCTCGCACTCTGGCTCGTCGATGCCGCCCTGTGCTGTCTGATTATCTGGAGGGTCCCC
TACACCGAGATCGACTGGACCGCGTACATGGAGCAGGTGGCGCAGTTCGTCTCCGGCGAGCGCGACTACACCAAG
ATGGAGGGAGGCACGGGTCCGCTCGTCTACCCGGCCGCGCACCTCTACACCTACACCGGGCTCTACTACCTGACG
GACCAGGGCAAGGACATCTTTCTCGCGCAGCAGCTCTTCGCCGTTCTCTACATGGCGACGCTCGCGCTGGTAATG
CTGTGCTATCGCCAGGCCGAGGCTCCGCCGTACATCCTGCCTCTCCTGATCCTGTCCAAGCGCCTCCACAGCATC
TTCGTCCTGCGCTGCTTCAACGACTGCTTCGCCGTCTTCTTCCTGTGGCTCGCCATCTTCTTTTTCCAGCGCCGG
TCCTGGACCTTTGGCGCCCTGGCCTACAGCTGGGGACTCGGCGTCAAGATGTCCCTGCTGCTGGTTCTCCCGGCC
GTCGGCCTCGTGCTCTTCCTGGGGCGCGGTTTCGGGGGGAGCCTGCGGCTGGCCTCGCTCATGGCGCAGCTGCAG
CTGCTCATCGCCCTCCCCTTCCTCCAGACCAACTGGAAGGGCTACCTGGGACGGGCGTTTGAGCTTTCGCGGCAG
TTCAAGTACGAGTGGACGGTCAATTGGCGGATGCTAGGCGAGCACCTCTTCCTCAGCAGGTCCTTGGCCCTGGCG
CTGCTCGCCCTGCATGCCCTGGTGCTCCTCATCTTCGTCGCGACGAGGTGGATGCGACCCGCGGACCGACCCCTG
TCCGCCCTGATGCCAGCCATGCTGCGCGGACAATCGCCCTTTGCGCTGCGAGAAGAGGTCCGGGTGTCCGGCCGA
GTCACGCCGGAGTACGTCATGACGACCGTCCTCTCCGCCAACGTCATCGGGCTGCTGTTCGCTCGGTCCCTCCAC
TACCAGTTCTACGCCTATCTCGCCTGGGCGACGCCGTACCTGCTGTGGGTGGCCGCGCCGCACCCGATCCTCGTG
CCCCTGCTCTGGCTGACGCAAGAATGGGCCTGGAACGTCTTCCCGAGCACCGACGCGAGCTCCGTCGTCGTCGTC
AACGCCCTGTTGATCACCGTCGGCTTGGTCTACTTCGGCACGCCGGGGGTCGACGATTTGCCCACGCGGCGGAAG
GCGGCGGAGAGGAAGAGCGAGTGA
Gene >Hirsu2|5989
ATGCCGCCGCCTCTGCCGCCCGCGGCACTGCGTACGTGGCACTTCGTCCGCGACGTCGCCTGTGGCCGGCATGCG
CTGTCGAGCCTCGTCCCTCTCGCACTCTGGCTCGTCGATGCCGCCCTGTGCTGTCTGATTATCTGGAGGGTCCCC
TGTTCGTTCCCGCCCCTCTCCCACCCGAGGGCGATGCGAGCCGTCCGCCGACATCGTTGCTGAAGAGCTGCCCCC
ATAGACACCGAGATCGACTGGACCGCGTACATGGAGCAGGTGGCGCAGTTCGTCTCCGGCGAGCGCGACTACACC
AAGATGGAGGGAGGCACGGGTCCGCTCGTCTACCCGGCCGCGCACCTCTACACCTACACCGGGCTCTACTACCTG
ACGGACCAGGGCAAGGACATCTTTCTCGCGCAGCAGCTCTTCGCCGTTCTCTACATGGCGACGCTCGCGCTGGTA
ATGCTGTGCTATCGCCAGGCCGAGGTCAGACTTTGTCCCGGCGCCCAGACGTGGAACGTGGCTAAGCTCGACAGC
AGGCTCCGCCGTACATCCTGCCTCTCCTGATCCTGTCCAAGCGCCTCCACAGCATCTTCGTCCTGCGCTGCTTCA
ACGACTGCTTCGCCGTCTTCTTCCTGTGGCTCGCCATCTTCTTTTTCCAGCGCCGGTCCTGGACCTTTGGCGCCC
TGGCCTACAGCTGGGGACTCGGCGTCAAGATGTCCCTGCTGCTGGTTCTCCCGGCCGTCGGCCTCGTGCTCTTCC
TGGGGCGCGGTTTCGGGGGGAGCCTGCGGCTGGCCTCGCTCATGGCGCAGCTGCAGCTGCTCATCGCCCTCCCCT
TCCTCCAGACCAACTGGAAGGGCTACCTGGGACGGGCGTTTGAGCTTTCGCGGCAGTTCAAGTACGAGTGGACGG
TCAATTGGCGGATGCTAGGCGAGCACCTCTTCCTCAGCAGGTCCTTGGCCCTGGCGCTGCTCGCCCTGCATGCCC
TGGTGCTCCTCATCTTCGTCGCGACGAGGTGGATGCGACCCGCGGACCGACCCCTGTCCGCCCTGATGCCAGCCA
TGCTGCGCGGACAATCGCCCTTTGCGCTGCGAGAAGAGGTCCGGGTGTCCGGCCGAGTCACGCCGGAGTACGTCA
TGACGACCGTCCTCTCCGCCAACGTCATCGGGCTGCTGTTCGCTCGGTCCCTCCACTACCAGTTCTACGCCTATC
TCGCCTGGGCGACGCCGTACCTGCTGTGGGTGGCCGCGCCGCACCCGATCCTCGTGCCCCTGCTCTGGCTGACGC
AAGAATGGGCCTGGAACGTCTTCCCGAGCACCGACGCGAGCTCCGTCGTCGTCGTCAACGCCCTGTTGATCACCG
TCGGCTTGGTCTACTTCGGCACGCCGGGGGTCGACGATTTGCCCACGCGGCGGAAGGCGGCGGAGAGGAAGAGCG
AGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail