Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5987
Gene name
LocationContig_302:189..1387
Strand-
Gene length (bp)1198
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.5E-10 90 231

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08280|BSC6_YEAST Bypass of stop codon protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BSC6 PE=1 SV=1 83 229 2.0E-06

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 84 106 22
2 116 138 22
3 151 173 22
4 178 200 22
5 207 229 22
6 273 295 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5987
MEANVLGSLVEVQSRPPAAPAKAVYRTYPGAPQDGDAIELRTQQRPDEEGAAGATPAPAADGDAPGREAVEAVVS
VWHPFMNRFRLLAFCLAYLGNALNDAAAGALIPYMEKYYDIGYGVVSLIFVGQAVGFVVAAALLDALRERLGRAR
LLGLGQGVMACGFVPLVAGAPFGAVAAAFVLVGFGASVNTAVGNTFCGALRDGTFMLGLLHGSYGVGGTAGPLIA
TALVAGAGAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRPRP
RMRRRRRRRRRGCCCRRCRARWRRRSGCASCCSARSSSSPTRAPRSPSRAGSCPS*
Coding >Hirsu2|5987
ATGGAGGCCAACGTGCTGGGAAGCCTCGTCGAGGTGCAGTCCCGCCCGCCGGCCGCGCCCGCCAAGGCCGTGTAC
CGGACGTACCCGGGAGCTCCGCAGGACGGCGACGCGATCGAGCTCCGGACGCAGCAGCGGCCGGACGAGGAGGGG
GCCGCGGGCGCGACGCCCGCTCCGGCAGCGGACGGCGACGCGCCGGGCCGCGAGGCCGTCGAGGCCGTCGTCAGC
GTGTGGCACCCGTTCATGAACCGCTTCCGCCTGCTGGCCTTCTGCCTGGCCTACCTGGGCAACGCGCTCAACGAC
GCCGCCGCCGGGGCTCTGATCCCGTACATGGAAAAGTATTACGACATCGGCTACGGCGTCGTGTCGCTCATCTTC
GTCGGGCAGGCCGTCGGCTTCGTCGTCGCGGCGGCGCTGCTGGACGCGCTGCGGGAGCGGCTGGGGCGGGCGCGG
CTGCTGGGCCTGGGCCAGGGCGTGATGGCGTGCGGCTTCGTGCCGCTGGTGGCGGGCGCGCCCTTCGGCGCCGTC
GCCGCCGCCTTCGTCCTCGTCGGCTTCGGCGCCTCGGTCAACACGGCCGTGGGCAACACCTTCTGCGGCGCCCTG
CGCGACGGCACCTTCATGCTCGGCCTGCTGCACGGCAGCTACGGCGTCGGCGGCACGGCGGGACCGCTTATCGCC
ACGGCGCTCGTCGCCGGCGCCGGCGCCGTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGACGAGGCCGAGGCCG
AGGATGAGGAGGCGACGACGGCGGCGGAGGCGCGGGTGCTGCTGCCGCCGCTGCCGGGCCCGCTGGCGACGGCGC
TCCGGCTGCGCGTCGTGCTGCTCGGCGCGCTCTTCATCTTCGCCTACCAGGGCGCCGAGGTCTCCATCTCGGGCT
GGGTCGTGTCCTTCCTGA
Transcript >Hirsu2|5987
ATGGAGGCCAACGTGCTGGGAAGCCTCGTCGAGGTGCAGTCCCGCCCGCCGGCCGCGCCCGCCAAGGCCGTGTAC
CGGACGTACCCGGGAGCTCCGCAGGACGGCGACGCGATCGAGCTCCGGACGCAGCAGCGGCCGGACGAGGAGGGG
GCCGCGGGCGCGACGCCCGCTCCGGCAGCGGACGGCGACGCGCCGGGCCGCGAGGCCGTCGAGGCCGTCGTCAGC
GTGTGGCACCCGTTCATGAACCGCTTCCGCCTGCTGGCCTTCTGCCTGGCCTACCTGGGCAACGCGCTCAACGAC
GCCGCCGCCGGGGCTCTGATCCCGTACATGGAAAAGTATTACGACATCGGCTACGGCGTCGTGTCGCTCATCTTC
GTCGGGCAGGCCGTCGGCTTCGTCGTCGCGGCGGCGCTGCTGGACGCGCTGCGGGAGCGGCTGGGGCGGGCGCGG
CTGCTGGGCCTGGGCCAGGGCGTGATGGCGTGCGGCTTCGTGCCGCTGGTGGCGGGCGCGCCCTTCGGCGCCGTC
GCCGCCGCCTTCGTCCTCGTCGGCTTCGGCGCCTCGGTCAACACGGCCGTGGGCAACACCTTCTGCGGCGCCCTG
CGCGACGGCACCTTCATGCTCGGCCTGCTGCACGGCAGCTACGGCGTCGGCGGCACGGCGGGACCGCTTATCGCC
ACGGCGCTCGTCGCCGGCGCCGGCGCCGTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGACGAGGCCGAGGCCG
AGGATGAGGAGGCGACGACGGCGGCGGAGGCGCGGGTGCTGCTGCCGCCGCTGCCGGGCCCGCTGGCGACGGCGC
TCCGGCTGCGCGTCGTGCTGCTCGGCGCGCTCTTCATCTTCGCCTACCAGGGCGCCGAGGTCTCCATCTCGGGCT
GGGTCGTGTCCTTCCTGA
Gene >Hirsu2|5987
ATGGAGGCCAACGTGCTGGGAAGCCTCGTCGAGGTGCAGTCCCGCCCGCCGGCCGCGCCCGCCAAGGCCGTGTAC
CGGACGTACCCGGGAGCTCCGCAGGACGGCGACGCGATCGAGCTCCGGACGCAGCAGCGGCCGGACGAGGAGGGG
GCCGCGGGCGCGACGCCCGCTCCGGCAGCGGACGGCGACGCGCCGGGCCGCGAGGCCGTCGAGGCCGTCGTCAGC
GTGTGGCACCCGTTCATGAACCGCTTCCGCCTGCTGGCCTTCTGCCTGGCCTACCTGGGCAACGCGCTCAACGAC
GCCGCCGCCGGGGCTCTGATCCCGTACATGGAAAAGTATGGACGTCTTGGTCGGGCGCCGCCATTCCCTGTCCTT
TACCCAACCGCCCAGCAGCGTGGCGAAGGAGAGAGACAGAGAGAGAGAGAACAGGGGGCTGACGCGTGACGGACA
CACGGGGGTCGCTAGGTATTACGACATCGGCTACGGCGTCGTGTCGCTCATCTTCGTCGGGCAGGCCGTCGGCTT
CGTCGTCGCGGCGGCGCTGCTGGACGCGCTGCGGGAGCGGCTGGGGCGGGCGCGGCTGCTGGGCCTGGGCCAGGG
CGTGATGGCGTGCGGCTTCGTGCCGCTGGTGGCGGGCGCGCCCTTCGGCGCCGTCGCCGCCGCCTTCGTCCTCGT
CGGCTTCGGCGCCTCGGTCAACACGGCCGTGGGCAACACCTTCTGCGGCGCCCTGCGCGACGGCACCTTCATGCT
CGGCCTGCTGCACGGCAGCTACGGCGTCGGCGGCACGGCGGGACCGCTTATCGCCACGGCGCTCGTCGCCGGCGC
CGGCGCCGTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGACGAGGCCGAGGCCGAGGATGAGGAGGCGACGACG
GCGGCGGAGGCGCGGGTGCTGCTGCCGCCGCTGCCGGGCCCGCTGGCGACGGCGCTCCGGCTGCGCGTCGTGCTG
CTCGGCGCGCTCTTCATCTTCGCCTACCAGGGCGCCGAGGTCTCCATCTCGGGCTGGGTCGTGTCCTTCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail