Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5980
Gene name
LocationContig_301:21694..23288
Strand-
Gene length (bp)1594
Transcript length (bp)1473
Coding sequence length (bp)1473
Protein length (aa) 491

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 5.1E-23 60 194
PF08031 BBE Berberine and berberine like 1.0E-12 433 477

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 49 480 6.0E-21
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 60 479 1.0E-20
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 60 479 1.0E-20
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 60 479 7.0E-20
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 60 479 6.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 49 480 6.0E-21
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 60 479 1.0E-20
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 60 479 1.0E-20
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 60 479 7.0E-20
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 60 479 6.0E-19
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 62 480 9.0E-19
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 60 479 1.0E-18
sp|Q9FZC5|FOX2_ARATH Flavin-dependent oxidoreductase FOX2 OS=Arabidopsis thaliana GN=FOX2 PE=2 SV=1 62 480 1.0E-17
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 37 479 3.0E-17
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 60 229 4.0E-17
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 5 490 7.0E-17
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 62 480 2.0E-16
sp|Q9SVG4|RETOL_ARATH Reticuline oxidase-like protein OS=Arabidopsis thaliana GN=At4g20830 PE=1 SV=2 52 477 2.0E-15
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 56 480 1.0E-14
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 52 479 1.0E-14
sp|Q7SGY1|ALO_NEUCR Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alo-1 PE=3 SV=1 24 241 3.0E-10
sp|Q0PCD7|AKNOX_STRGJ Aclacinomycin-N/aclacinomycin-A oxidase OS=Streptomyces galilaeus GN=aknOx PE=1 SV=1 52 479 3.0E-09
sp|P30986|RETO_ESCCA Reticuline oxidase OS=Eschscholzia californica GN=BBE1 PE=1 SV=1 60 479 6.0E-09
sp|P93479|RETO_PAPSO Reticuline oxidase OS=Papaver somniferum GN=BBE1 PE=2 SV=1 60 479 3.0E-08
sp|P58710|GGLO_MOUSE L-gulonolactone oxidase OS=Mus musculus GN=Gulo PE=1 SV=3 59 215 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5980
MTAWLSLSALWSLCSARALQTVSASLPSCLAQAGVPFLVSDSSDWAGEIMPYNVRLNYTPAAVAMPQSVAQIQAA
VSCGVRNRARITAKGGGHSFGSFGLGGEDGHLVIGFEHMRRVVVKDDNTATIQAGARLLDVATELYNQGRRALPH
GSVGIAGHVLHGGFGYASRTHGLTLDWLTGATVVLADASVVHCSAIENQDLFWALRGAGSSFGIVAEFEFDTFEA
PNQVTSFSLDLPSWERADAVEAISSLQRFAVSAPRELNLMLDITPTDKTFQGVYYGNQRGLHEALRPLLSDVGGN
FSSASTVGWLEGLLKFDDLDPADPRDTFYATSLVTRALDGGQIESLVSSLAAASPPSLRRSLYLSIEAHGGINSA
VADVGSSATAYPHRDKLLLFQLFHGGSQGRYDDNGFGLVETVRRSVTDSVAGGEWGMYSNYLDTQLDAPAAGELY
WGSNLPRLRRIKADLDPYEVFWNPQGIQPADSLYKAGYEL*
Coding >Hirsu2|5980
ATGACGGCATGGCTCTCCCTGTCCGCCCTTTGGTCGCTGTGCTCTGCCAGGGCGCTCCAGACCGTCTCGGCCAGC
CTGCCGTCTTGTCTGGCTCAAGCAGGTGTCCCATTCTTGGTCAGCGACTCGAGCGACTGGGCTGGTGAAATCATG
CCATACAATGTTCGGCTGAACTACACGCCAGCCGCCGTTGCCATGCCGCAGTCCGTCGCCCAGATCCAAGCGGCT
GTCTCGTGCGGCGTAAGGAACCGAGCGCGCATCACCGCCAAGGGCGGCGGTCACAGCTTCGGCTCTTTCGGGCTC
GGCGGCGAGGATGGGCATCTGGTGATCGGCTTCGAGCACATGCGTCGGGTGGTGGTCAAGGACGACAATACGGCA
ACGATCCAAGCAGGCGCCAGGCTGCTGGACGTGGCGACGGAACTGTACAACCAGGGGCGAAGAGCGCTGCCTCAC
GGCTCTGTTGGCATCGCGGGTCATGTCTTGCACGGCGGCTTCGGCTACGCCTCGCGAACGCACGGCCTCACGCTC
GACTGGCTGACGGGCGCAACGGTTGTCCTTGCCGATGCCTCCGTGGTCCATTGTTCCGCCATCGAGAACCAGGAT
CTTTTCTGGGCCCTGCGAGGGGCTGGATCGTCGTTTGGGATCGTTGCCGAATTCGAGTTCGACACCTTCGAGGCA
CCAAACCAAGTCACCTCGTTCAGTCTTGACCTGCCCTCGTGGGAGCGAGCCGACGCGGTCGAGGCCATCAGTTCC
CTGCAAAGATTCGCCGTCTCGGCCCCCAGAGAACTGAACCTAATGCTCGATATAACGCCGACGGACAAGACCTTC
CAGGGCGTATACTACGGGAATCAAAGGGGACTCCACGAGGCGCTGCGGCCGCTGCTGAGCGACGTTGGCGGTAAC
TTCTCGTCTGCGAGCACCGTTGGATGGCTTGAAGGGCTATTGAAGTTCGACGACCTCGACCCTGCCGACCCTCGT
GACACATTTTACGCGACCAGCCTAGTTACGCGTGCCCTCGATGGCGGCCAAATCGAGTCGCTTGTGTCGAGCCTC
GCTGCCGCCAGCCCGCCTTCTCTGCGCCGTTCGTTGTATCTGAGCATCGAAGCGCACGGGGGAATCAACTCGGCC
GTTGCCGATGTCGGCTCGTCGGCGACCGCATACCCTCATCGTGACAAGTTGCTGCTGTTCCAGCTCTTCCATGGG
GGGTCTCAGGGCCGCTACGACGACAACGGCTTCGGCCTTGTGGAGACGGTGAGAAGAAGCGTCACAGACTCCGTG
GCCGGCGGTGAATGGGGTATGTACTCGAATTATCTCGACACGCAATTGGACGCCCCGGCTGCTGGTGAGTTGTAC
TGGGGGAGCAACCTGCCGCGGTTGCGAAGAATCAAGGCCGACTTGGATCCGTATGAGGTGTTTTGGAACCCCCAG
GGCATCCAGCCTGCAGACTCTCTGTACAAAGCAGGATATGAATTGTGA
Transcript >Hirsu2|5980
ATGACGGCATGGCTCTCCCTGTCCGCCCTTTGGTCGCTGTGCTCTGCCAGGGCGCTCCAGACCGTCTCGGCCAGC
CTGCCGTCTTGTCTGGCTCAAGCAGGTGTCCCATTCTTGGTCAGCGACTCGAGCGACTGGGCTGGTGAAATCATG
CCATACAATGTTCGGCTGAACTACACGCCAGCCGCCGTTGCCATGCCGCAGTCCGTCGCCCAGATCCAAGCGGCT
GTCTCGTGCGGCGTAAGGAACCGAGCGCGCATCACCGCCAAGGGCGGCGGTCACAGCTTCGGCTCTTTCGGGCTC
GGCGGCGAGGATGGGCATCTGGTGATCGGCTTCGAGCACATGCGTCGGGTGGTGGTCAAGGACGACAATACGGCA
ACGATCCAAGCAGGCGCCAGGCTGCTGGACGTGGCGACGGAACTGTACAACCAGGGGCGAAGAGCGCTGCCTCAC
GGCTCTGTTGGCATCGCGGGTCATGTCTTGCACGGCGGCTTCGGCTACGCCTCGCGAACGCACGGCCTCACGCTC
GACTGGCTGACGGGCGCAACGGTTGTCCTTGCCGATGCCTCCGTGGTCCATTGTTCCGCCATCGAGAACCAGGAT
CTTTTCTGGGCCCTGCGAGGGGCTGGATCGTCGTTTGGGATCGTTGCCGAATTCGAGTTCGACACCTTCGAGGCA
CCAAACCAAGTCACCTCGTTCAGTCTTGACCTGCCCTCGTGGGAGCGAGCCGACGCGGTCGAGGCCATCAGTTCC
CTGCAAAGATTCGCCGTCTCGGCCCCCAGAGAACTGAACCTAATGCTCGATATAACGCCGACGGACAAGACCTTC
CAGGGCGTATACTACGGGAATCAAAGGGGACTCCACGAGGCGCTGCGGCCGCTGCTGAGCGACGTTGGCGGTAAC
TTCTCGTCTGCGAGCACCGTTGGATGGCTTGAAGGGCTATTGAAGTTCGACGACCTCGACCCTGCCGACCCTCGT
GACACATTTTACGCGACCAGCCTAGTTACGCGTGCCCTCGATGGCGGCCAAATCGAGTCGCTTGTGTCGAGCCTC
GCTGCCGCCAGCCCGCCTTCTCTGCGCCGTTCGTTGTATCTGAGCATCGAAGCGCACGGGGGAATCAACTCGGCC
GTTGCCGATGTCGGCTCGTCGGCGACCGCATACCCTCATCGTGACAAGTTGCTGCTGTTCCAGCTCTTCCATGGG
GGGTCTCAGGGCCGCTACGACGACAACGGCTTCGGCCTTGTGGAGACGGTGAGAAGAAGCGTCACAGACTCCGTG
GCCGGCGGTGAATGGGGTATGTACTCGAATTATCTCGACACGCAATTGGACGCCCCGGCTGCTGGTGAGTTGTAC
TGGGGGAGCAACCTGCCGCGGTTGCGAAGAATCAAGGCCGACTTGGATCCGTATGAGGTGTTTTGGAACCCCCAG
GGCATCCAGCCTGCAGACTCTCTGTACAAAGCAGGATATGAATTGTGA
Gene >Hirsu2|5980
ATGACGGCATGGCTCTCCCTGTCCGCCCTTTGGTCGCTGTGCTCTGCCAGGGCGCTCCAGACCGTCTCGGCCAGC
CTGCCGTCTTGTCTGGCTCAAGCAGGTGTCCCATTCTTGGTCAGCGACTCGAGCGACTGGGCTGGTGAAATCATG
CCATACAATGTTCGGCTGAACTACACGCCAGCCGCCGTTGCCATGCCGCAGTCCGTCGCCCAGATCCAAGCGGCT
GTCTCGTGCGGCGTAAGGAACCGAGCGCGCATCACCGCCAAGGGCGGCGGTCACAGCTTCGGCTCTTTCGGGCTC
GGCGGCGAGGATGGGCATCTGGTGATCGGCTTCGAGCACATGCGTCGGGTGGTGGTCAAGGACGACAATACGGCA
ACGATCCAAGCAGGCGCCAGGCTGCTGGACGTGGCGACGGAACTGTACAACCAGGGGCGAAGAGCGCTGCCTCAC
GGCTCGTGCATGAGGCGAGCGCTCGCGTGTCCCCGCCGCGGCATTTCGCCATCGCTGATCGGTGTTGCAGTGTTG
GCATCGCGGGTCATGTCTTGCACGGCGGCTTCGGCTACGCCTCGCGAACGCACGGCCTCACGCTCGACTGGCTGA
CGGGCGCAACGGTTGTCCTTGCCGATGCCTCCGTGGTCCATTGTTCCGCCATCGAGAACCAGGATCTTTTCTGGG
CCCTGCGAGGGGCTGGATCGTCGTTTGGGATCGTTGCCGAATTCGAGTTCGACACCTTCGAGGCACCAAACCAAG
TCACCTCGTTCAGTCTTGACCTGCCCTCGTGGGAGCGAGCCGACGCGGTCGAGGCCATCAGTTCCCTGCAAAGAT
TCGCCGTCTCGGCCCCCAGAGAACTGAACCTAATGCTCGATATAACGCCGACGGACAAGACCTTCCAGGGCGTAT
ACTACGGGAATCAAAGGGGACTCCACGAGGCGCTGCGGCCGCTGCTGAGCGACGTTGGCGGTAACTTCTCGTCTG
CGAGCACCGTTGGATGGCTTGAAGGGCTATTGAAGTTCGACGACCTCGACCCTGCCGACCCTGTTTGTGTCCCCC
CTTGGCGATGGAGAGACCGACCACCGGGGCTGATTCTTCGCAGCGTGACACATTTTACGCGACCAGCCTAGTTAC
GCGTGCCCTCGATGGCGGCCAAATCGAGTCGCTTGTGTCGAGCCTCGCTGCCGCCAGCCCGCCTTCTCTGCGCCG
TTCGTTGTATCTGAGCATCGAAGCGCACGGGGGAATCAACTCGGCCGTTGCCGATGTCGGCTCGTCGGCGACCGC
ATACCCTCATCGTGACAAGTTGCTGCTGTTCCAGCTCTTCCATGGGGGGTCTCAGGGCCGCTACGACGACAACGG
CTTCGGCCTTGTGGAGACGGTGAGAAGAAGCGTCACAGACTCCGTGGCCGGCGGTGAATGGGGTATGTACTCGAA
TTATCTCGACACGCAATTGGACGCCCCGGCTGCTGGTGAGTTGTACTGGGGGAGCAACCTGCCGCGGTTGCGAAG
AATCAAGGCCGACTTGGATCCGTATGAGGTGTTTTGGAACCCCCAGGGCATCCAGCCTGCAGACTCTCTGTACAA
AGCAGGATATGAATTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail