Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5977
Gene name
LocationContig_301:13880..14279
Strand-
Gene length (bp)399
Transcript length (bp)324
Coding sequence length (bp)324
Protein length (aa) 108

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05768 Glrx-like Glutaredoxin-like domain (DUF836) 1.0E-11 12 99

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q05530|YD286_YEAST Glutaredoxin-like protein YDR286C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR286C PE=3 SV=1 1 105 1.0E-10
sp|Q9CWB7|YD286_MOUSE Glutaredoxin-like protein C5orf63 homolog OS=Mus musculus PE=1 SV=1 13 104 1.0E-10

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1854 0.1191 0.0089 0.0506 0.9718 0.0135 0.052 0.0622 0.0633 0.0221

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5437
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3692
Ophiocordyceps australis map64 (Brazil) OphauB2|2233
Ophiocordyceps camponoti-floridani Ophcf2|04529
Ophiocordyceps camponoti-rufipedis Ophun1|3282
Ophiocordyceps kimflemingae Ophio5|5068
Ophiocordyceps subramaniannii Hirsu2|5977 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5977
MFASRRLLNACRITFFTRDNCGLCQEAAQVLSDVSKKRPFVCKKVNLALPESTPWRELYDFDIPVVHIAKTAAEE
EQVAMAGHAVKLMHRFTPAQVEAKMDQVEASG*
Coding >Hirsu2|5977
ATGTTCGCCTCAAGACGTCTACTCAACGCCTGCAGAATCACCTTCTTCACGCGCGACAACTGCGGCCTCTGCCAA
GAGGCGGCCCAGGTGCTTTCTGACGTCAGCAAGAAGCGACCGTTCGTCTGCAAAAAGGTGAACCTGGCGCTGCCC
GAGTCCACGCCGTGGAGAGAGTTGTACGACTTTGACATACCCGTCGTGCACATCGCCAAGACCGCAGCGGAAGAG
GAACAGGTGGCAATGGCGGGCCATGCCGTCAAGCTAATGCACCGATTCACGCCTGCGCAAGTCGAAGCCAAGATG
GACCAGGTGGAAGCCAGCGGATAG
Transcript >Hirsu2|5977
ATGTTCGCCTCAAGACGTCTACTCAACGCCTGCAGAATCACCTTCTTCACGCGCGACAACTGCGGCCTCTGCCAA
GAGGCGGCCCAGGTGCTTTCTGACGTCAGCAAGAAGCGACCGTTCGTCTGCAAAAAGGTGAACCTGGCGCTGCCC
GAGTCCACGCCGTGGAGAGAGTTGTACGACTTTGACATACCCGTCGTGCACATCGCCAAGACCGCAGCGGAAGAG
GAACAGGTGGCAATGGCGGGCCATGCCGTCAAGCTAATGCACCGATTCACGCCTGCGCAAGTCGAAGCCAAGATG
GACCAGGTGGAAGCCAGCGGATAG
Gene >Hirsu2|5977
ATGTTCGCCTCAAGACGTCTACTCAACGCCTGCAGAATCACCTTCTTCACGCGCGACAACTGCGGCCTCTGCCAA
GAGGCGGCCCAGGTGCTTTCTGACGTCAGCAAGAAGCGACCGTTCGTCTGCAAAAAGGTGAACCTGGCGCTGCCC
GAGTCCACGCCGTGGAGAGAGTTGTACGACTTTGACATACCCGTCGTAAGTCTCTGCCGTCCTTTGTTCTTCTTC
TCCTTGTTACCATCGTCCAATCGGGATTGACCGCAGACTATCTAGGTGCACATCGCCAAGACCGCAGCGGAAGAG
GAACAGGTGGCAATGGCGGGCCATGCCGTCAAGCTAATGCACCGATTCACGCCTGCGCAAGTCGAAGCCAAGATG
GACCAGGTGGAAGCCAGCGGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail