Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5972
Gene name
LocationContig_301:4732..5480
Strand-
Gene length (bp)748
Transcript length (bp)573
Coding sequence length (bp)573
Protein length (aa) 191

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06127 DUF962 Protein of unknown function (DUF962) 1.6E-26 4 159

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P25338|YGB0_YEAST Uncharacterized endoplasmic reticulum membrane protein YGL010W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL010W PE=1 SV=2 3 185 7.0E-28
sp|O13737|YDR2_SCHPO Uncharacterized endoplasmic reticulum membrane protein C16E8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.02 PE=4 SV=2 5 174 2.0E-27

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 67 89 22
3 110 129 19
4 139 161 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5972
MSLDLERHLTFYGAYHHNSVNVAIHMVCVPLILVSGFCMATYTGTLIHTPPWLTVPHLDLNLGTIAAVVYACLYV
LLEPVAGFVLAAFCVGSTALANHMRVEDPQTTFRTALFVHIISWVAQFVGHGAFEGRAPALLDNLVQAVFLAPMF
VWLEILFKLGYRRELQSRVEKGVQEEIAKFKAQSKNGKAH*
Coding >Hirsu2|5972
ATGTCCCTGGACCTGGAGAGGCATCTGACCTTCTATGGCGCCTATCATCACAATTCGGTCAACGTGGCCATTCAC
ATGGTCTGCGTCCCGCTCATCCTGGTCTCGGGCTTCTGCATGGCCACATATACCGGCACCCTGATCCACACGCCC
CCGTGGCTGACCGTCCCTCACCTCGATCTCAACCTGGGCACCATAGCCGCCGTCGTCTACGCCTGTCTCTACGTC
CTGTTAGAGCCCGTCGCCGGCTTCGTTCTCGCCGCCTTCTGCGTCGGAAGCACCGCCTTGGCAAACCACATGCGC
GTCGAGGACCCTCAAACAACCTTCCGCACCGCCCTCTTCGTGCACATTATCTCGTGGGTCGCCCAGTTTGTCGGC
CACGGCGCCTTCGAGGGACGTGCCCCCGCCCTGCTCGACAACCTCGTACAAGCCGTCTTCCTGGCGCCCATGTTT
GTCTGGCTCGAGATCCTCTTCAAGCTCGGCTACCGCAGGGAATTGCAGAGCCGTGTGGAAAAGGGCGTGCAGGAG
GAGATTGCCAAGTTCAAGGCACAGTCGAAAAACGGCAAGGCGCACTAG
Transcript >Hirsu2|5972
ATGTCCCTGGACCTGGAGAGGCATCTGACCTTCTATGGCGCCTATCATCACAATTCGGTCAACGTGGCCATTCAC
ATGGTCTGCGTCCCGCTCATCCTGGTCTCGGGCTTCTGCATGGCCACATATACCGGCACCCTGATCCACACGCCC
CCGTGGCTGACCGTCCCTCACCTCGATCTCAACCTGGGCACCATAGCCGCCGTCGTCTACGCCTGTCTCTACGTC
CTGTTAGAGCCCGTCGCCGGCTTCGTTCTCGCCGCCTTCTGCGTCGGAAGCACCGCCTTGGCAAACCACATGCGC
GTCGAGGACCCTCAAACAACCTTCCGCACCGCCCTCTTCGTGCACATTATCTCGTGGGTCGCCCAGTTTGTCGGC
CACGGCGCCTTCGAGGGACGTGCCCCCGCCCTGCTCGACAACCTCGTACAAGCCGTCTTCCTGGCGCCCATGTTT
GTCTGGCTCGAGATCCTCTTCAAGCTCGGCTACCGCAGGGAATTGCAGAGCCGTGTGGAAAAGGGCGTGCAGGAG
GAGATTGCCAAGTTCAAGGCACAGTCGAAAAACGGCAAGGCGCACTAG
Gene >Hirsu2|5972
ATGTCCCTGGACCTGGAGAGGCATCTGACCTTCGTACGTCGCCAAGCTGCCGGTGCCCGTGGATGGAGTCTGCTC
CGTCTGTTCCATGCCGTGCCGACCGATACTGACCTGGCCGCCTCCCTCCCTTGCAGTATGGCGCCTATCATCACA
ATTCGGTCAACGTGGCCATTCACATGGTCTGCGTCCCGCTCATCCTGGTCTCGGGCTTCTGCATGGTACGGCTCG
TCCCCTCCCCCCCTCCTCGAGTCCGTCGACGACCCGGCCAAGCTCCTAATCTCGGGCTGTCTGCTAGGCCACATA
TACCGGCACCCTGATCCACACGCCCCCGTGGCTGACCGTCCCTCACCTCGATCTCAACCTGGGCACCATAGCCGC
CGTCGTCTACGCCTGTCTCTACGTCCTGTTAGAGCCCGTCGCCGGCTTCGTTCTCGCCGCCTTCTGCGTCGGAAG
CACCGCCTTGGCAAACCACATGCGCGTCGAGGACCCTCAAACAACCTTCCGCACCGCCCTCTTCGTGCACATTAT
CTCGTGGGTCGCCCAGTTTGTCGGCCACGGCGCCTTCGAGGGACGTGCCCCCGCCCTGCTCGACAACCTCGTACA
AGCCGTCTTCCTGGCGCCCATGTTTGTCTGGCTCGAGATCCTCTTCAAGCTCGGCTACCGCAGGGAATTGCAGAG
CCGTGTGGAAAAGGGCGTGCAGGAGGAGATTGCCAAGTTCAAGGCACAGTCGAAAAACGGCAAGGCGCACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail