Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5968
Gene name
LocationContig_3007:155..1298
Strand+
Gene length (bp)1143
Transcript length (bp)864
Coding sequence length (bp)864
Protein length (aa) 288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04161 Arv1 Arv1-like family 8.3E-76 3 217

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDX5|ARV1_SCHPO Protein arv1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arv1 PE=3 SV=3 4 267 1.0E-41
sp|Q54GD9|ARV1_DICDI Protein arv1 homolog OS=Dictyostelium discoideum GN=arv1 PE=3 SV=1 3 249 2.0E-25
sp|Q5ANH2|ARV1_CANAL Protein ARV1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARV1 PE=3 SV=1 3 234 4.0E-25
sp|Q750Q7|ARV1_ASHGO Protein ARV1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARV1 PE=3 SV=1 3 278 1.0E-22
sp|Q9H2C2|ARV1_HUMAN Protein ARV1 OS=Homo sapiens GN=ARV1 PE=2 SV=1 4 235 4.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDX5|ARV1_SCHPO Protein arv1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arv1 PE=3 SV=3 4 267 1.0E-41
sp|Q54GD9|ARV1_DICDI Protein arv1 homolog OS=Dictyostelium discoideum GN=arv1 PE=3 SV=1 3 249 2.0E-25
sp|Q5ANH2|ARV1_CANAL Protein ARV1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARV1 PE=3 SV=1 3 234 4.0E-25
sp|Q750Q7|ARV1_ASHGO Protein ARV1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARV1 PE=3 SV=1 3 278 1.0E-22
sp|Q9H2C2|ARV1_HUMAN Protein ARV1 OS=Homo sapiens GN=ARV1 PE=2 SV=1 4 235 4.0E-15
sp|Q3SZW3|ARV1_BOVIN Protein ARV1 OS=Bos taurus GN=ARV1 PE=2 SV=1 4 235 7.0E-15
sp|Q9D0U9|ARV1_MOUSE Protein ARV1 OS=Mus musculus GN=Arv1 PE=2 SV=1 4 222 7.0E-15
sp|Q06541|ARV1_YEAST Protein ARV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARV1 PE=1 SV=1 3 247 1.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 84 103 19
2 126 148 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5968
MPICIECRHPAKTLWTRYSGAGDQSSVYNIRLTVCRQCGSFCDKYVEHDFIVLFIDLVLIKPQVYRHLLHNSLMR
DGGRFDPSIIRLGVLLLLFDVYLTWARIEKQTSPATLPGEINLGKLAQQPIVLQYLFFLILCSLSTLAFHVSIRS
LACSSLSPLCSLKLMVRHATPNSVSTALLVSSSTKLFPILMVIWEYDVPAAARSLGWAVVANNVEALRILLDCKY
HIACILAIAGAASRWIIGRLVLAAAGLGDVDSISEGSVAADGKALWALLMLIREWAGRLAVG*
Coding >Hirsu2|5968
ATGCCTATTTGTATCGAATGTCGACACCCGGCCAAGACCCTCTGGACACGGTACTCTGGGGCAGGCGATCAATCA
AGCGTATACAACATCCGATTGACTGTTTGCCGCCAATGCGGGTCGTTTTGCGACAAGTATGTTGAACATGACTTC
ATCGTACTGTTTATCGACCTTGTCTTGATTAAGCCTCAGGTCTACCGCCACCTACTGCATAACAGCTTGATGCGC
GATGGTGGTCGTTTCGATCCATCTATCATTCGACTCGGAGTCTTGTTACTACTCTTTGACGTTTATCTGACTTGG
GCGCGCATCGAGAAGCAAACATCTCCCGCTACGCTACCCGGTGAAATCAATCTTGGCAAGCTTGCGCAACAGCCC
ATTGTCCTACAATACCTATTTTTCTTGATCCTGTGTAGCCTCTCGACATTGGCGTTCCACGTCAGCATTCGCTCT
CTTGCTTGTTCATCGCTCTCCCCGTTATGCTCGCTTAAACTTATGGTTCGCCACGCAACTCCGAATTCCGTCTCC
ACAGCCCTCCTCGTTTCGTCGTCAACCAAACTTTTCCCCATCTTGATGGTAATCTGGGAATACGATGTCCCTGCG
GCTGCAAGATCACTAGGCTGGGCTGTTGTAGCCAACAATGTCGAGGCTTTGCGTATACTGCTGGACTGCAAATAT
CACATCGCTTGCATCCTGGCTATTGCAGGGGCAGCGTCGCGATGGATCATTGGTAGACTCGTTCTTGCTGCCGCT
GGGTTGGGCGATGTCGATTCGATCAGCGAAGGCAGCGTGGCGGCCGATGGTAAGGCTTTGTGGGCCCTGTTGATG
CTGATAAGGGAGTGGGCGGGACGTCTAGCCGTGGGATGA
Transcript >Hirsu2|5968
ATGCCTATTTGTATCGAATGTCGACACCCGGCCAAGACCCTCTGGACACGGTACTCTGGGGCAGGCGATCAATCA
AGCGTATACAACATCCGATTGACTGTTTGCCGCCAATGCGGGTCGTTTTGCGACAAGTATGTTGAACATGACTTC
ATCGTACTGTTTATCGACCTTGTCTTGATTAAGCCTCAGGTCTACCGCCACCTACTGCATAACAGCTTGATGCGC
GATGGTGGTCGTTTCGATCCATCTATCATTCGACTCGGAGTCTTGTTACTACTCTTTGACGTTTATCTGACTTGG
GCGCGCATCGAGAAGCAAACATCTCCCGCTACGCTACCCGGTGAAATCAATCTTGGCAAGCTTGCGCAACAGCCC
ATTGTCCTACAATACCTATTTTTCTTGATCCTGTGTAGCCTCTCGACATTGGCGTTCCACGTCAGCATTCGCTCT
CTTGCTTGTTCATCGCTCTCCCCGTTATGCTCGCTTAAACTTATGGTTCGCCACGCAACTCCGAATTCCGTCTCC
ACAGCCCTCCTCGTTTCGTCGTCAACCAAACTTTTCCCCATCTTGATGGTAATCTGGGAATACGATGTCCCTGCG
GCTGCAAGATCACTAGGCTGGGCTGTTGTAGCCAACAATGTCGAGGCTTTGCGTATACTGCTGGACTGCAAATAT
CACATCGCTTGCATCCTGGCTATTGCAGGGGCAGCGTCGCGATGGATCATTGGTAGACTCGTTCTTGCTGCCGCT
GGGTTGGGCGATGTCGATTCGATCAGCGAAGGCAGCGTGGCGGCCGATGGTAAGGCTTTGTGGGCCCTGTTGATG
CTGATAAGGGAGTGGGCGGGACGTCTAGCCGTGGGATGA
Gene >Hirsu2|5968
ATGCCTATTTGTATCGAATGTCGACACCCGGCCAAGACCCTCTGGACACGGTACTCTGGGGCAGGCGATCAATCA
AGCGTATACAACATCCGATTGACTGTTTGCCGCCAATGCGGGTCGTTTTGCGACAAGTATGTTGAACATGACTTC
ATCGTACTGTTTATCGACCTTGTCTTGATTAAGCCTCAGGTTGGTGAGATCTTGTCGTAATCTCGATGGATAGTC
GTTTACATACTGTTACATTTCATTATATAATTTTAGGTCTACCGCCACCTACTGCATAACAGCTTGATGCGCGAT
GGTGGTCGTTTCGATGTCAGTATGACCCGATCCGAGATCGAGTGGTGTCAAGACCCGGTCGCAGCTATGATTTTG
CGAGACCCCAATTTCGACCACTTTTCGAAAAATGCACTGACAAGCCTTGTATGCTCACTGCTTAGCCATCTATCA
TTCGACTCGGAGTCTTGTTACTACTCTTTGACGTTTATCTGACTTGGGCGCGCATCGAGAAGCAAACATCTCCCG
CTACGCTACCCGGTGAAATCAATCTTGGCAAGCTTGCGCAACAGCCCATTGTCCTACAATACCTATTTTTCTGTC
TGTGCAATCCAAGCCTCGTCACTCACCGAGAATGACTTCTTGTCCCTGATCCTCATCAATGGAACTAATATTTGC
GCAGTGATCCTGTGTAGCCTCTCGACATTGGCGTTCCACGTCAGCATTCGCTCTCTTGCTTGTTCATCGCTCTCC
CCGTTATGCTCGCTTAAACTTATGGTTCGCCACGCAACTCCGAATTCCGTCTCCACAGCCCTCCTCGTTTCGTCG
TCAACCAAACTTTTCCCCATCTTGATGGTAATCTGGGAATACGATGTCCCTGCGGCTGCAAGATCACTAGGCTGG
GCTGTTGTAGCCAACAATGTCGAGGCTTTGCGTATACTGCTGGACTGCAAATATCACATCGCTTGCATCCTGGCT
ATTGCAGGGGCAGCGTCGCGATGGATCATTGGTAGACTCGTTCTTGCTGCCGCTGGGTTGGGCGATGTCGATTCG
ATCAGCGAAGGCAGCGTGGCGGCCGATGGTAAGGCTTTGTGGGCCCTGTTGATGCTGATAAGGGAGTGGGCGGGA
CGTCTAGCCGTGGGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail