Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5963
Gene name
LocationContig_300:19037..21080
Strand-
Gene length (bp)2043
Transcript length (bp)1749
Coding sequence length (bp)1749
Protein length (aa) 583

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00615 RGS Regulator of G protein signaling domain 1.1E-05 364 555

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 55 74 19
3 89 111 22
4 153 175 22
5 204 226 22
6 239 261 22
7 271 293 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5963
MGSELGVTADSKPEPVLNTVSIFWASLACVWTALLVAGMAYLVSRRNTPMLRIRGLSLSLAAIVLLHLYWISVQL
GTMIGPLAPGDAEFWIMGIYLPFGIALFHASNSRFLHIAEAQKKYLHGSHRSDGVAARSRSKRGVFARFRRLDYT
SKILIVVGMGMLFQLFLTILMYLISRKFHRSFGIRGTEIHGTEMQQKMQMGRGWEWWPSVFWQFFWAWIVAPIIL
WRSRGINDTQGWRFQTIACSIVNLHAAPMWLIALYVPEMDVVNQYWIPPQWIAVSIMLTEVFTVFLPCWEVMRHQ
TLRQETLDSIAQWESKNKAFASGAKSLNSATTMVESMMSGFKSTNGSVRTNDSGESILTMSALEHVLERNPGPLQ
QFSALRDFSGENIAFLTSVADWKNSLPPGVRDSTSVQSDKQNKQLLHERFNRALHIYAEFISTRDAEFPINISSQ
DLKKLEGVFEKSARSLFGDKRDVDPATPFDTPAFASRPPMTPTSSSFSSEKGIMSPGSQACGAAEDRAQYWGEVP
ENFDVAVFDDAEKSIKYLVLTNTWPKFVKDRRSSVDGFESLEAQSDAVMGARNRQVN*
Coding >Hirsu2|5963
ATGGGGTCCGAACTCGGGGTCACGGCCGATTCCAAGCCGGAGCCGGTTCTCAACACCGTCAGCATCTTCTGGGCA
TCGCTAGCATGCGTCTGGACGGCGCTGCTCGTGGCCGGCATGGCCTACTTGGTATCGCGCCGCAACACGCCTATG
CTCCGAATTCGCGGGCTGAGCCTCTCCCTCGCGGCCATCGTGTTGCTCCATCTGTATTGGATCTCAGTCCAGCTC
GGAACTATGATCGGGCCCCTGGCGCCAGGCGATGCCGAGTTTTGGATCATGGGCATCTATCTGCCCTTCGGCATT
GCCCTCTTCCATGCCTCCAACAGCCGTTTCCTCCACATCGCCGAGGCGCAGAAGAAGTATCTTCATGGCAGCCAC
CGCTCTGATGGCGTCGCAGCTCGCTCCAGGAGTAAGCGTGGCGTGTTCGCCCGCTTTCGTCGACTTGACTATACG
TCAAAAATCCTCATCGTCGTCGGCATGGGAATGTTGTTTCAGCTCTTCCTCACCATCCTCATGTATCTCATTTCC
CGCAAGTTTCACCGGTCCTTTGGCATTCGTGGAACCGAGATTCACGGAACCGAAATGCAGCAGAAAATGCAGATG
GGCAGAGGGTGGGAATGGTGGCCTTCCGTGTTTTGGCAGTTCTTCTGGGCCTGGATTGTCGCGCCCATCATCCTC
TGGCGATCTCGAGGCATCAACGACACCCAGGGCTGGAGGTTTCAGACCATTGCTTGTTCCATCGTCAATCTACAC
GCCGCTCCTATGTGGCTGATTGCCTTGTATGTACCGGAAATGGATGTCGTTAACCAGTACTGGATCCCTCCTCAG
TGGATCGCAGTTTCTATCATGTTGACGGAAGTCTTCACCGTCTTCCTGCCTTGCTGGGAGGTGATGCGTCATCAA
ACCCTGCGACAGGAGACTCTCGACTCGATCGCTCAGTGGGAGTCGAAGAATAAGGCTTTCGCGTCGGGTGCCAAG
TCTCTCAACTCGGCCACTACGATGGTTGAGTCCATGATGTCCGGTTTCAAATCCACAAACGGCTCCGTCAGGACC
AACGACTCGGGCGAGAGTATTCTCACCATGAGTGCTCTCGAGCATGTGCTGGAGCGCAATCCCGGCCCACTTCAG
CAGTTCTCTGCTCTCAGGGACTTTTCTGGAGAGAACATCGCGTTCCTCACCAGCGTAGCTGACTGGAAGAACTCG
CTGCCTCCGGGGGTTCGAGATAGCACCTCGGTGCAAAGCGACAAGCAGAATAAGCAGCTCCTCCACGAGCGATTC
AACCGAGCTCTTCACATCTACGCCGAATTCATCAGCACGCGCGACGCGGAATTCCCCATCAACATCTCGTCACAG
GATCTGAAGAAGTTGGAGGGTGTTTTCGAGAAATCGGCTCGGTCCCTGTTTGGCGACAAGCGAGATGTCGATCCG
GCCACGCCGTTTGACACGCCGGCCTTTGCTTCAAGACCCCCAATGACGCCCACCTCTTCATCGTTCAGTTCCGAA
AAGGGCATCATGTCACCTGGTTCTCAAGCCTGCGGCGCGGCTGAGGACCGCGCCCAGTATTGGGGCGAGGTCCCC
GAAAACTTCGACGTGGCGGTCTTCGACGATGCCGAGAAGAGCATCAAATATCTTGTGCTCACCAACACCTGGCCT
AAATTTGTAAAGGATCGCAGGTCGTCCGTCGATGGTTTTGAAAGTCTGGAGGCTCAGAGCGACGCCGTTATGGGG
GCTCGTAATCGCCAGGTGAATTGA
Transcript >Hirsu2|5963
ATGGGGTCCGAACTCGGGGTCACGGCCGATTCCAAGCCGGAGCCGGTTCTCAACACCGTCAGCATCTTCTGGGCA
TCGCTAGCATGCGTCTGGACGGCGCTGCTCGTGGCCGGCATGGCCTACTTGGTATCGCGCCGCAACACGCCTATG
CTCCGAATTCGCGGGCTGAGCCTCTCCCTCGCGGCCATCGTGTTGCTCCATCTGTATTGGATCTCAGTCCAGCTC
GGAACTATGATCGGGCCCCTGGCGCCAGGCGATGCCGAGTTTTGGATCATGGGCATCTATCTGCCCTTCGGCATT
GCCCTCTTCCATGCCTCCAACAGCCGTTTCCTCCACATCGCCGAGGCGCAGAAGAAGTATCTTCATGGCAGCCAC
CGCTCTGATGGCGTCGCAGCTCGCTCCAGGAGTAAGCGTGGCGTGTTCGCCCGCTTTCGTCGACTTGACTATACG
TCAAAAATCCTCATCGTCGTCGGCATGGGAATGTTGTTTCAGCTCTTCCTCACCATCCTCATGTATCTCATTTCC
CGCAAGTTTCACCGGTCCTTTGGCATTCGTGGAACCGAGATTCACGGAACCGAAATGCAGCAGAAAATGCAGATG
GGCAGAGGGTGGGAATGGTGGCCTTCCGTGTTTTGGCAGTTCTTCTGGGCCTGGATTGTCGCGCCCATCATCCTC
TGGCGATCTCGAGGCATCAACGACACCCAGGGCTGGAGGTTTCAGACCATTGCTTGTTCCATCGTCAATCTACAC
GCCGCTCCTATGTGGCTGATTGCCTTGTATGTACCGGAAATGGATGTCGTTAACCAGTACTGGATCCCTCCTCAG
TGGATCGCAGTTTCTATCATGTTGACGGAAGTCTTCACCGTCTTCCTGCCTTGCTGGGAGGTGATGCGTCATCAA
ACCCTGCGACAGGAGACTCTCGACTCGATCGCTCAGTGGGAGTCGAAGAATAAGGCTTTCGCGTCGGGTGCCAAG
TCTCTCAACTCGGCCACTACGATGGTTGAGTCCATGATGTCCGGTTTCAAATCCACAAACGGCTCCGTCAGGACC
AACGACTCGGGCGAGAGTATTCTCACCATGAGTGCTCTCGAGCATGTGCTGGAGCGCAATCCCGGCCCACTTCAG
CAGTTCTCTGCTCTCAGGGACTTTTCTGGAGAGAACATCGCGTTCCTCACCAGCGTAGCTGACTGGAAGAACTCG
CTGCCTCCGGGGGTTCGAGATAGCACCTCGGTGCAAAGCGACAAGCAGAATAAGCAGCTCCTCCACGAGCGATTC
AACCGAGCTCTTCACATCTACGCCGAATTCATCAGCACGCGCGACGCGGAATTCCCCATCAACATCTCGTCACAG
GATCTGAAGAAGTTGGAGGGTGTTTTCGAGAAATCGGCTCGGTCCCTGTTTGGCGACAAGCGAGATGTCGATCCG
GCCACGCCGTTTGACACGCCGGCCTTTGCTTCAAGACCCCCAATGACGCCCACCTCTTCATCGTTCAGTTCCGAA
AAGGGCATCATGTCACCTGGTTCTCAAGCCTGCGGCGCGGCTGAGGACCGCGCCCAGTATTGGGGCGAGGTCCCC
GAAAACTTCGACGTGGCGGTCTTCGACGATGCCGAGAAGAGCATCAAATATCTTGTGCTCACCAACACCTGGCCT
AAATTTGTAAAGGATCGCAGGTCGTCCGTCGATGGTTTTGAAAGTCTGGAGGCTCAGAGCGACGCCGTTATGGGG
GCTCGTAATCGCCAGGTGAATTGA
Gene >Hirsu2|5963
ATGGGGTCCGAACTCGGGGTCACGGCCGATTCCAAGCCGGAGCCGGTTCTCAACACCGTCAGCATCTTCTGGGCA
TCGCTAGCATGCGTCTGGACGGCGCTGCTCGTGGCCGGCATGGCCTACTTGGTATCGCGCCGCAACACGCCTATG
CTCCGAATTCGCGGGCTGAGCCTCTCCCTCGCGGCCATCGTGTTGCTCCATCTGTATTGGATCTCAGTCCAGCTC
GGAACTATGATCGGGCCCCTGGCGCCAGGCGATGCCGAGTTTTGGATCATGGGCATCTATCTGCCCTTCGGCATT
GCCCTCTTCCATGCCTCCAACAGCCGTTTCCTCCACATCGCCGAGGCGCAGAAGAAGTATCTTCATGGCAGCCAC
CGCTCTGATGGCGTCGCAGCTCGCTCCAGGAGTAAGCGTGGCGTGTTCGCCCGCTTTCGTCGACTTGACTATACG
TCAAAAATCCTCATCGTCGTCGGCATGGGAATGTTGTTTCAGGTGAGAAAGAGCACACTCTCGTTGCCACCACGA
GATCAAACCCCCGGCAGCGTGACTTCTTGCTGACTTTACCCCAAATCCACAGCTCTTCCTCACCATCCTCATGTA
TCTCATTTCCCGCAAGTTTCACCGGTCCTTTGGCATTCGTGGAACCGAGATTCACGGAACCGAAATGCAGCAGAA
AATGCAGATGGGCAGAGGGTGGGAATGGTAAGAAGCCTGAACATTCGGCTCTGTTCATGGTATGGCTCGATATCC
TGACAAAACTCTCGGCGCGAACAGGTGGCCTTCCGTGTTTTGGCAGTTCTTCTGGGCCTGGATTGTCGCGCCCAT
CATCCTCTGGCGATCTCGAGGCATCAACGACACCCAGGGCTGGAGGTTTCAGACCATTGCTTGTTCCATCGTCAA
GTAAGAAGAGTTCAAGCCCTTCCTGTTCTTAAAACGAAAGAACACTTTACTGACAGATGCCAGTCTACACGCCGC
TCCTATGTGGCTGATTGCCTTGTATGTACCGGAAATGGATGTCGTTAACCAGTACTGGATCCCTCCTCAGTGGTA
TGTTATCGACCAATCTTGCTTCTCAATAGTCGTCGATCTTCTGAAGTGTCTGACACTTTGTCCCGAAACAGGATC
GCAGTTTCTATCATGTTGACGGAAGTCTTCACCGTCTTCCTGCCTTGCTGGGAGGTGATGCGTCATCAAACCCTG
CGACAGGAGACTCTCGACTCGATCGCTCAGTGGGAGTCGAAGAATAAGGCTTTCGCGTCGGGTGCCAAGTCTCTC
AACTCGGCCACTACGATGGTTGAGTCCATGATGTCCGGTTTCAAATCCACAAACGGCTCCGTCAGGACCAACGAC
TCGGGCGAGAGTATTCTCACCATGAGTGCTCTCGAGCATGTGCTGGAGCGCAATCCCGGCCCACTTCAGCAGTTC
TCTGCTCTCAGGGACTTTTCTGGAGAGAACATCGCGTTCCTCACCAGCGTAGCTGACTGGAAGAACTCGCTGCCT
CCGGGGGTTCGAGATAGCACCTCGGTGCAAAGCGACAAGCAGAATAAGCAGCTCCTCCACGAGCGATTCAACCGA
GCTCTTCACATCTACGCCGAATTCATCAGCACGCGCGACGCGGAATTCCCCATCAACATCTCGTCACAGGATCTG
AAGAAGTTGGAGGGTGTTTTCGAGAAATCGGCTCGGTCCCTGTTTGGCGACAAGCGAGATGTCGATCCGGCCACG
CCGTTTGACACGCCGGCCTTTGCTTCAAGACCCCCAATGACGCCCACCTCTTCATCGTTCAGTTCCGAAAAGGGC
ATCATGTCACCTGGTTCTCAAGCCTGCGGCGCGGCTGAGGACCGCGCCCAGTATTGGGGCGAGGTCCCCGAAAAC
TTCGACGTGGCGGTCTTCGACGATGCCGAGAAGAGCATCAAATATCTTGTGCTCACCAACACCTGGCCTAAATTT
GTAAAGGATCGCAGGTCGTCCGTCGATGGTTTTGAAAGTCTGGAGGCTCAGAGCGACGCCGTTATGGGGGCTCGT
AATCGCCAGGTGAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail