Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5957
Gene name
LocationContig_30:52312..53095
Strand-
Gene length (bp)783
Transcript length (bp)699
Coding sequence length (bp)699
Protein length (aa) 233

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 7.7E-06 2 36
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 5.4E-07 6 33
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 3.5E-06 3 36
PF00890 FAD_binding_2 FAD binding domain 1.9E-06 4 33

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 3 206 2.0E-18
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 17 199 3.0E-11
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 22 206 9.0E-08
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 2 198 1.0E-07
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 2 228 7.0E-06

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0071949 FAD binding Yes
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0000166 nucleotide binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0003824 catalytic activity No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular 0.5772 0.369 0.6556 0.0759 0.1139 0.0975 0.0824 0.044 0.0735 0.0204

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup479
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1118
Ophiocordyceps australis 1348a (Ghana) OphauG2|3185
Ophiocordyceps australis map64 (Brazil) OphauB2|1595
Ophiocordyceps australis map64 (Brazil) OphauB2|1649
Ophiocordyceps australis map64 (Brazil) OphauB2|8025
Ophiocordyceps subramaniannii Hirsu2|10599
Ophiocordyceps subramaniannii Hirsu2|5957 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9131

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5957
MVTVLIVGAGIAGLSAAISLRRAGHRVRVYERSALNNEIGAAINVPPNATRFLTAWGLDPVRWRFVRSRRITFMD
PFTLDVTGLLSADKSPRDVGGAELYYAHRVDLHNALKWMATRQDGPGVPVTIHVQANVIGYNPLKPSIVLQSGEQ
VEGDVVIGADGIHSLAAETVLGHKNQPVPPVHSNCCYRFLIPAATLDEDPETRFWNEGRDGWTRMFPDNETKRRI
VVYPCRE*
Coding >Hirsu2|5957
ATGGTCACCGTTCTCATCGTTGGTGCCGGAATCGCAGGTCTTTCAGCCGCCATTTCCCTTCGTCGAGCCGGGCAC
CGCGTCCGTGTCTACGAGCGTTCTGCCTTGAACAACGAGATAGGCGCGGCCATCAACGTGCCGCCCAACGCCACC
CGCTTCCTCACCGCATGGGGACTTGATCCTGTGCGCTGGCGCTTCGTCCGTTCCCGCCGCATCACCTTCATGGAC
CCCTTCACCCTCGACGTTACGGGCCTCCTTTCGGCCGACAAAAGCCCTCGGGATGTTGGCGGCGCCGAGCTCTAC
TATGCCCACCGGGTAGATCTCCACAATGCCCTCAAGTGGATGGCAACCCGTCAAGACGGCCCAGGCGTACCGGTG
ACGATTCACGTTCAGGCGAACGTGATAGGCTACAATCCACTGAAGCCGTCCATCGTCCTGCAAAGCGGCGAACAA
GTTGAGGGCGATGTTGTTATCGGCGCAGACGGCATCCACTCCCTCGCGGCGGAGACGGTCCTCGGCCACAAGAAC
CAACCGGTGCCGCCGGTCCATTCCAACTGCTGCTATCGCTTCCTAATCCCCGCCGCCACCCTCGACGAGGACCCC
GAAACTCGGTTCTGGAACGAGGGCCGAGACGGCTGGACAAGAATGTTCCCCGACAACGAGACGAAGCGAAGGATC
GTCGTGTATCCATGTCGGGAGTAA
Transcript >Hirsu2|5957
ATGGTCACCGTTCTCATCGTTGGTGCCGGAATCGCAGGTCTTTCAGCCGCCATTTCCCTTCGTCGAGCCGGGCAC
CGCGTCCGTGTCTACGAGCGTTCTGCCTTGAACAACGAGATAGGCGCGGCCATCAACGTGCCGCCCAACGCCACC
CGCTTCCTCACCGCATGGGGACTTGATCCTGTGCGCTGGCGCTTCGTCCGTTCCCGCCGCATCACCTTCATGGAC
CCCTTCACCCTCGACGTTACGGGCCTCCTTTCGGCCGACAAAAGCCCTCGGGATGTTGGCGGCGCCGAGCTCTAC
TATGCCCACCGGGTAGATCTCCACAATGCCCTCAAGTGGATGGCAACCCGTCAAGACGGCCCAGGCGTACCGGTG
ACGATTCACGTTCAGGCGAACGTGATAGGCTACAATCCACTGAAGCCGTCCATCGTCCTGCAAAGCGGCGAACAA
GTTGAGGGCGATGTTGTTATCGGCGCAGACGGCATCCACTCCCTCGCGGCGGAGACGGTCCTCGGCCACAAGAAC
CAACCGGTGCCGCCGGTCCATTCCAACTGCTGCTATCGCTTCCTAATCCCCGCCGCCACCCTCGACGAGGACCCC
GAAACTCGGTTCTGGAACGAGGGCCGAGACGGCTGGACAAGAATGTTCCCCGACAACGAGACGAAGCGAAGGATC
GTCGTGTATCCATGTCGGGAGTAA
Gene >Hirsu2|5957
ATGGTCACCGTTCTCATCGTTGGTGCCGGAATCGCAGGTCTTTCAGCCGCCATTTCCCTTCGTCGAGCCGGGCAC
CGCGTCCGTGTCTACGAGCGTTCTGCCTTGAACAACGAGATAGGCGCGGCCATCAACGTGCCGCCCAACGCCACC
CGCTTCCTCACCGCATGGGGACTTGATCCTGTGCGCTGGCGCTTCGTCCGTTCCCGCCGCATCACCTTCATGGAC
CCCTTCACCCTCGACGTTACGGGCCTCCTTTCGGCCGACAAAAGCCCTCGGGATGTTGGCGGCGCCGAGCTCTAC
TATGCCCACCGGGTAGATCTCCACAATGCCCTCAAGTGGATGGCAACCCGTCAAGACGGCCCAGGCGTACCGGTG
ACGATTCACGTTCAGGCGAACGTGATAGGCTACGTACGCGAGCCCATGCCTTGATCAGTCGTGCATCACGGGACG
CCAAAATTGGCATTGTTCTAACGCCCGCATGGGTATGATTAGAATCCACTGAAGCCGTCCATCGTCCTGCAAAGC
GGCGAACAAGTTGAGGGCGATGTTGTTATCGGCGCAGACGGCATCCACTCCCTCGCGGCGGAGACGGTCCTCGGC
CACAAGAACCAACCGGTGCCGCCGGTCCATTCCAACTGCTGCTATCGCTTCCTAATCCCCGCCGCCACCCTCGAC
GAGGACCCCGAAACTCGGTTCTGGAACGAGGGCCGAGACGGCTGGACAAGAATGTTCCCCGACAACGAGACGAAG
CGAAGGATCGTCGTGTATCCATGTCGGGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail