Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5957
Gene name
LocationContig_30:52312..53095
Strand-
Gene length (bp)783
Transcript length (bp)699
Coding sequence length (bp)699
Protein length (aa) 233

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 7.0E-06 2 36
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 5.0E-07 6 33
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 2.6E-06 3 36
PF00890 FAD_binding_2 FAD binding domain 1.7E-06 4 33

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 3 206 2.0E-18
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 17 199 3.0E-11
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 22 206 9.0E-08
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 2 198 1.0E-07
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 2 228 7.0E-06

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0071949 FAD binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0050660 flavin adenine dinucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5957
MVTVLIVGAGIAGLSAAISLRRAGHRVRVYERSALNNEIGAAINVPPNATRFLTAWGLDPVRWRFVRSRRITFMD
PFTLDVTGLLSADKSPRDVGGAELYYAHRVDLHNALKWMATRQDGPGVPVTIHVQANVIGYNPLKPSIVLQSGEQ
VEGDVVIGADGIHSLAAETVLGHKNQPVPPVHSNCCYRFLIPAATLDEDPETRFWNEGRDGWTRMFPDNETKRRI
VVYPCRE*
Coding >Hirsu2|5957
ATGGTCACCGTTCTCATCGTTGGTGCCGGAATCGCAGGTCTTTCAGCCGCCATTTCCCTTCGTCGAGCCGGGCAC
CGCGTCCGTGTCTACGAGCGTTCTGCCTTGAACAACGAGATAGGCGCGGCCATCAACGTGCCGCCCAACGCCACC
CGCTTCCTCACCGCATGGGGACTTGATCCTGTGCGCTGGCGCTTCGTCCGTTCCCGCCGCATCACCTTCATGGAC
CCCTTCACCCTCGACGTTACGGGCCTCCTTTCGGCCGACAAAAGCCCTCGGGATGTTGGCGGCGCCGAGCTCTAC
TATGCCCACCGGGTAGATCTCCACAATGCCCTCAAGTGGATGGCAACCCGTCAAGACGGCCCAGGCGTACCGGTG
ACGATTCACGTTCAGGCGAACGTGATAGGCTACAATCCACTGAAGCCGTCCATCGTCCTGCAAAGCGGCGAACAA
GTTGAGGGCGATGTTGTTATCGGCGCAGACGGCATCCACTCCCTCGCGGCGGAGACGGTCCTCGGCCACAAGAAC
CAACCGGTGCCGCCGGTCCATTCCAACTGCTGCTATCGCTTCCTAATCCCCGCCGCCACCCTCGACGAGGACCCC
GAAACTCGGTTCTGGAACGAGGGCCGAGACGGCTGGACAAGAATGTTCCCCGACAACGAGACGAAGCGAAGGATC
GTCGTGTATCCATGTCGGGAGTAA
Transcript >Hirsu2|5957
ATGGTCACCGTTCTCATCGTTGGTGCCGGAATCGCAGGTCTTTCAGCCGCCATTTCCCTTCGTCGAGCCGGGCAC
CGCGTCCGTGTCTACGAGCGTTCTGCCTTGAACAACGAGATAGGCGCGGCCATCAACGTGCCGCCCAACGCCACC
CGCTTCCTCACCGCATGGGGACTTGATCCTGTGCGCTGGCGCTTCGTCCGTTCCCGCCGCATCACCTTCATGGAC
CCCTTCACCCTCGACGTTACGGGCCTCCTTTCGGCCGACAAAAGCCCTCGGGATGTTGGCGGCGCCGAGCTCTAC
TATGCCCACCGGGTAGATCTCCACAATGCCCTCAAGTGGATGGCAACCCGTCAAGACGGCCCAGGCGTACCGGTG
ACGATTCACGTTCAGGCGAACGTGATAGGCTACAATCCACTGAAGCCGTCCATCGTCCTGCAAAGCGGCGAACAA
GTTGAGGGCGATGTTGTTATCGGCGCAGACGGCATCCACTCCCTCGCGGCGGAGACGGTCCTCGGCCACAAGAAC
CAACCGGTGCCGCCGGTCCATTCCAACTGCTGCTATCGCTTCCTAATCCCCGCCGCCACCCTCGACGAGGACCCC
GAAACTCGGTTCTGGAACGAGGGCCGAGACGGCTGGACAAGAATGTTCCCCGACAACGAGACGAAGCGAAGGATC
GTCGTGTATCCATGTCGGGAGTAA
Gene >Hirsu2|5957
ATGGTCACCGTTCTCATCGTTGGTGCCGGAATCGCAGGTCTTTCAGCCGCCATTTCCCTTCGTCGAGCCGGGCAC
CGCGTCCGTGTCTACGAGCGTTCTGCCTTGAACAACGAGATAGGCGCGGCCATCAACGTGCCGCCCAACGCCACC
CGCTTCCTCACCGCATGGGGACTTGATCCTGTGCGCTGGCGCTTCGTCCGTTCCCGCCGCATCACCTTCATGGAC
CCCTTCACCCTCGACGTTACGGGCCTCCTTTCGGCCGACAAAAGCCCTCGGGATGTTGGCGGCGCCGAGCTCTAC
TATGCCCACCGGGTAGATCTCCACAATGCCCTCAAGTGGATGGCAACCCGTCAAGACGGCCCAGGCGTACCGGTG
ACGATTCACGTTCAGGCGAACGTGATAGGCTACGTACGCGAGCCCATGCCTTGATCAGTCGTGCATCACGGGACG
CCAAAATTGGCATTGTTCTAACGCCCGCATGGGTATGATTAGAATCCACTGAAGCCGTCCATCGTCCTGCAAAGC
GGCGAACAAGTTGAGGGCGATGTTGTTATCGGCGCAGACGGCATCCACTCCCTCGCGGCGGAGACGGTCCTCGGC
CACAAGAACCAACCGGTGCCGCCGGTCCATTCCAACTGCTGCTATCGCTTCCTAATCCCCGCCGCCACCCTCGAC
GAGGACCCCGAAACTCGGTTCTGGAACGAGGGCCGAGACGGCTGGACAAGAATGTTCCCCGACAACGAGACGAAG
CGAAGGATCGTCGTGTATCCATGTCGGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail