Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5956
Gene name
LocationContig_30:49290..49917
Strand+
Gene length (bp)627
Transcript length (bp)627
Coding sequence length (bp)627
Protein length (aa) 209

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 2.8E-13 62 152
PF08241 Methyltransf_11 Methyltransferase domain 8.9E-12 63 155
PF13489 Methyltransf_23 Methyltransferase domain 8.9E-11 56 196
PF13847 Methyltransf_31 Methyltransferase domain 1.5E-08 59 160
PF05175 MTS Methyltransferase small domain 2.1E-07 43 107
PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) 6.6E-07 45 127

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N6F8|WBS27_HUMAN Williams-Beuren syndrome chromosomal region 27 protein OS=Homo sapiens GN=WBSCR27 PE=1 SV=2 2 158 7.0E-22
sp|A7GHH4|PRMA_CLOBL Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=prmA PE=3 SV=1 45 157 7.0E-07
sp|B1ILM1|PRMA_CLOBK Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=prmA PE=3 SV=1 45 157 7.0E-07
sp|C1FVT8|PRMA_CLOBJ Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=prmA PE=3 SV=1 45 157 7.0E-07
sp|A5I638|PRMA_CLOBH Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=prmA PE=3 SV=1 45 157 7.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N6F8|WBS27_HUMAN Williams-Beuren syndrome chromosomal region 27 protein OS=Homo sapiens GN=WBSCR27 PE=1 SV=2 2 158 7.0E-22
sp|A7GHH4|PRMA_CLOBL Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=prmA PE=3 SV=1 45 157 7.0E-07
sp|B1ILM1|PRMA_CLOBK Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=prmA PE=3 SV=1 45 157 7.0E-07
sp|C1FVT8|PRMA_CLOBJ Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=prmA PE=3 SV=1 45 157 7.0E-07
sp|A5I638|PRMA_CLOBH Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=prmA PE=3 SV=1 45 157 7.0E-07
sp|A7FXL3|PRMA_CLOB1 Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=prmA PE=3 SV=1 45 157 7.0E-07
sp|A6LRN8|PRMA_CLOB8 Ribosomal protein L11 methyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=prmA PE=3 SV=1 45 157 7.0E-07
sp|B1KZN5|PRMA_CLOBM Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=prmA PE=3 SV=1 44 157 7.0E-07
sp|Q482G8|UBIG_COLP3 Ubiquinone biosynthesis O-methyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=ubiG PE=3 SV=1 38 193 3.0E-06
sp|C3L3G5|PRMA_CLOB6 Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=prmA PE=3 SV=1 44 111 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5956
MANIARAYGLASTAEARSLYDEWAATFDEEMASASQDYVAPAIATKCLVDSLKSQNLTDIKILDAGCGTGLVGAH
LAKLGAKHIDGVDLSPGMLEVARQTGNYKSLKTADLSQPLDCPSNTYQVVMCIGTLTQGHVGPEVLFDFARAVEQ
GGLVIATVLSTIWESGGYSDAVTRMVRERKVSLVSDEIEDYRRGAGVQARMVILRVLS*
Coding >Hirsu2|5956
ATGGCCAATATTGCACGTGCGTACGGCCTGGCAAGCACGGCAGAAGCCAGGTCACTCTACGACGAATGGGCTGCC
ACCTTTGACGAAGAAATGGCTTCGGCCTCCCAAGATTACGTCGCTCCAGCAATCGCCACCAAGTGTCTGGTGGAC
AGCCTGAAATCGCAAAACTTGACGGATATCAAGATCCTCGACGCAGGCTGCGGCACTGGCCTTGTTGGCGCGCAC
CTCGCCAAGCTAGGCGCGAAACATATCGATGGTGTCGACTTGAGCCCCGGCATGCTCGAAGTCGCACGACAGACC
GGCAACTATAAGTCTTTAAAGACGGCGGATCTGTCTCAGCCCCTCGACTGTCCAAGCAATACTTACCAGGTAGTC
ATGTGCATTGGGACCCTGACTCAAGGCCATGTCGGGCCCGAGGTCTTATTCGATTTCGCTCGTGCCGTCGAGCAG
GGCGGGCTTGTCATCGCAACAGTTCTCTCGACGATCTGGGAAAGTGGAGGCTACAGTGATGCAGTGACCAGGATG
GTGCGAGAACGCAAGGTGAGCTTGGTGAGCGATGAGATCGAGGACTATCGGCGTGGGGCCGGAGTGCAGGCTCGC
ATGGTAATACTCAGGGTGCTTTCGTAG
Transcript >Hirsu2|5956
ATGGCCAATATTGCACGTGCGTACGGCCTGGCAAGCACGGCAGAAGCCAGGTCACTCTACGACGAATGGGCTGCC
ACCTTTGACGAAGAAATGGCTTCGGCCTCCCAAGATTACGTCGCTCCAGCAATCGCCACCAAGTGTCTGGTGGAC
AGCCTGAAATCGCAAAACTTGACGGATATCAAGATCCTCGACGCAGGCTGCGGCACTGGCCTTGTTGGCGCGCAC
CTCGCCAAGCTAGGCGCGAAACATATCGATGGTGTCGACTTGAGCCCCGGCATGCTCGAAGTCGCACGACAGACC
GGCAACTATAAGTCTTTAAAGACGGCGGATCTGTCTCAGCCCCTCGACTGTCCAAGCAATACTTACCAGGTAGTC
ATGTGCATTGGGACCCTGACTCAAGGCCATGTCGGGCCCGAGGTCTTATTCGATTTCGCTCGTGCCGTCGAGCAG
GGCGGGCTTGTCATCGCAACAGTTCTCTCGACGATCTGGGAAAGTGGAGGCTACAGTGATGCAGTGACCAGGATG
GTGCGAGAACGCAAGGTGAGCTTGGTGAGCGATGAGATCGAGGACTATCGGCGTGGGGCCGGAGTGCAGGCTCGC
ATGGTAATACTCAGGGTGCTTTCGTAG
Gene >Hirsu2|5956
ATGGCCAATATTGCACGTGCGTACGGCCTGGCAAGCACGGCAGAAGCCAGGTCACTCTACGACGAATGGGCTGCC
ACCTTTGACGAAGAAATGGCTTCGGCCTCCCAAGATTACGTCGCTCCAGCAATCGCCACCAAGTGTCTGGTGGAC
AGCCTGAAATCGCAAAACTTGACGGATATCAAGATCCTCGACGCAGGCTGCGGCACTGGCCTTGTTGGCGCGCAC
CTCGCCAAGCTAGGCGCGAAACATATCGATGGTGTCGACTTGAGCCCCGGCATGCTCGAAGTCGCACGACAGACC
GGCAACTATAAGTCTTTAAAGACGGCGGATCTGTCTCAGCCCCTCGACTGTCCAAGCAATACTTACCAGGTAGTC
ATGTGCATTGGGACCCTGACTCAAGGCCATGTCGGGCCCGAGGTCTTATTCGATTTCGCTCGTGCCGTCGAGCAG
GGCGGGCTTGTCATCGCAACAGTTCTCTCGACGATCTGGGAAAGTGGAGGCTACAGTGATGCAGTGACCAGGATG
GTGCGAGAACGCAAGGTGAGCTTGGTGAGCGATGAGATCGAGGACTATCGGCGTGGGGCCGGAGTGCAGGCTCGC
ATGGTAATACTCAGGGTGCTTTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail