Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5955
Gene name
LocationContig_30:44666..46526
Strand-
Gene length (bp)1860
Transcript length (bp)1860
Coding sequence length (bp)1860
Protein length (aa) 620

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.2E-15 83 171
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.1E-14 144 206
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.6E-12 210 271
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.0E-11 243 305
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.4E-11 268 339
PF12796 Ank_2 Ankyrin repeats (3 copies) 8.3E-10 308 372
PF12796 Ank_2 Ankyrin repeats (3 copies) 8.8E-17 347 440
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.6E-09 425 497
PF13606 Ank_3 Ankyrin repeat 1.2E-03 144 168
PF13606 Ank_3 Ankyrin repeat 1.0E-04 243 271
PF13606 Ank_3 Ankyrin repeat 4.4E-03 276 303
PF13606 Ank_3 Ankyrin repeat 2.1E-04 375 402
PF13606 Ank_3 Ankyrin repeat 8.7E-04 409 436
PF13637 Ank_4 Ankyrin repeats (many copies) 1.4E-05 114 164
PF13637 Ank_4 Ankyrin repeats (many copies) 6.3E-07 146 198
PF13637 Ank_4 Ankyrin repeats (many copies) 1.2E-06 179 231
PF13637 Ank_4 Ankyrin repeats (many copies) 4.7E-09 245 297
PF13637 Ank_4 Ankyrin repeats (many copies) 3.9E-06 316 355
PF13637 Ank_4 Ankyrin repeats (many copies) 1.9E-10 350 396
PF13637 Ank_4 Ankyrin repeats (many copies) 4.6E-07 380 425
PF13637 Ank_4 Ankyrin repeats (many copies) 2.1E-08 410 460
PF00023 Ank Ankyrin repeat 2.0E-02 144 170
PF00023 Ank Ankyrin repeat 2.2E-04 178 206
PF00023 Ank Ankyrin repeat 2.3E-04 212 235
PF00023 Ank Ankyrin repeat 1.4E-03 243 271
PF00023 Ank Ankyrin repeat 1.4E-05 276 303
PF00023 Ank Ankyrin repeat 2.5E-03 309 341
PF00023 Ank Ankyrin repeat 1.8E-02 343 371
PF00023 Ank Ankyrin repeat 6.1E-06 375 406
PF00023 Ank Ankyrin repeat 1.9E-02 409 441
PF13857 Ank_5 Ankyrin repeats (many copies) 7.4E-07 230 284
PF13857 Ank_5 Ankyrin repeats (many copies) 4.6E-08 362 413

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 50 495 1.0E-62
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 50 495 2.0E-62
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 104 495 7.0E-62
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 104 495 6.0E-61
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 53 495 4.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 50 495 1.0E-62
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 50 495 2.0E-62
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 104 495 7.0E-62
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 104 495 6.0E-61
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 53 495 4.0E-60
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 83 496 7.0E-59
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 53 485 7.0E-59
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 53 485 2.0E-58
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 50 512 5.0E-58
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 83 496 1.0E-57
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 53 480 1.0E-57
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 50 528 1.0E-56
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 83 496 1.0E-56
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 24 498 6.0E-56
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 83 492 6.0E-56
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 83 533 2.0E-55
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 83 497 9.0E-55
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 32 499 1.0E-54
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 32 499 8.0E-54
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 53 492 1.0E-53
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 50 485 3.0E-53
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 83 536 3.0E-53
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 49 536 6.0E-53
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 83 498 7.0E-53
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 46 496 1.0E-52
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 96 496 1.0E-52
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 102 496 1.0E-52
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 102 535 2.0E-52
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 26 463 3.0E-52
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 83 516 4.0E-52
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 33 486 4.0E-52
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 83 498 5.0E-52
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 33 432 7.0E-52
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 46 496 2.0E-51
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 83 563 2.0E-51
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 103 496 3.0E-51
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 83 496 3.0E-51
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 83 496 3.0E-51
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 50 535 4.0E-51
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 96 496 4.0E-51
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 112 512 9.0E-51
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 50 498 1.0E-50
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 83 496 2.0E-50
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 34 432 2.0E-50
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 83 523 3.0E-50
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 110 499 5.0E-50
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 103 496 8.0E-50
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 96 496 8.0E-50
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 83 428 2.0E-49
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 50 498 8.0E-49
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 95 430 8.0E-49
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 34 455 2.0E-48
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 117 533 8.0E-48
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 82 498 1.0E-47
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 83 428 3.0E-47
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 97 430 1.0E-46
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 115 486 6.0E-46
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 105 466 7.0E-46
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 97 430 3.0E-45
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 115 430 3.0E-45
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 50 496 4.0E-45
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 105 466 4.0E-45
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 87 536 9.0E-45
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 87 536 1.0E-44
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 152 538 1.0E-43
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 105 497 1.0E-43
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 83 497 1.0E-43
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 152 508 2.0E-43
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 53 527 2.0E-43
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 80 509 4.0E-43
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 83 496 4.0E-43
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 117 536 6.0E-43
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 51 535 7.0E-43
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 34 401 2.0E-42
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 50 529 2.0E-42
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 83 497 2.0E-42
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 152 508 3.0E-42
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 83 416 4.0E-42
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 50 529 4.0E-42
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 115 466 7.0E-42
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 83 419 8.0E-42
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 152 538 1.0E-41
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 152 498 2.0E-41
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 51 512 3.0E-41
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 180 498 3.0E-41
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 148 506 5.0E-41
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 148 506 5.0E-41
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 102 413 1.0E-40
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 51 547 2.0E-40
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 180 496 2.0E-40
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 60 413 2.0E-40
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 83 487 2.0E-40
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 180 496 3.0E-40
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 148 506 4.0E-40
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 155 506 4.0E-40
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 145 533 7.0E-40
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 26 528 1.0E-39
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 86 528 1.0E-39
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 180 498 1.0E-39
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 155 506 2.0E-39
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 119 429 2.0E-39
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 83 416 3.0E-39
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 148 506 4.0E-39
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 26 528 4.0E-39
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 83 487 6.0E-39
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 83 416 6.0E-39
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 82 400 7.0E-39
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 115 429 1.0E-38
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 115 430 2.0E-38
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 148 506 2.0E-38
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 148 506 2.0E-38
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 148 506 3.0E-38
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 180 496 1.0E-37
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 142 428 1.0E-37
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 141 496 4.0E-37
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 147 465 4.0E-37
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 105 487 4.0E-37
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 144 496 6.0E-37
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 82 400 8.0E-37
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 180 496 9.0E-37
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 95 485 2.0E-36
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 149 464 4.0E-36
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 152 496 7.0E-36
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 116 508 1.0E-35
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 158 533 2.0E-35
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 157 496 2.0E-35
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 185 496 2.0E-35
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 191 496 2.0E-35
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 83 464 3.0E-35
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 113 508 5.0E-35
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 55 538 5.0E-35
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 83 396 6.0E-35
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 157 496 7.0E-35
sp|Q5UQJ2|YR863_MIMIV Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 9 406 9.0E-35
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 45 512 1.0E-34
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 131 463 1.0E-34
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 148 487 1.0E-34
sp|Q5URB9|YR840_MIMIV Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 33 400 1.0E-34
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 159 509 1.0E-34
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 83 432 2.0E-34
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 148 487 2.0E-34
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 161 496 3.0E-34
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 116 508 4.0E-34
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 45 512 4.0E-34
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 147 460 5.0E-34
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 83 396 6.0E-34
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 151 466 6.0E-34
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 144 416 6.0E-34
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 83 332 7.0E-34
sp|Q5UR04|YR911_MIMIV Putative ankyrin repeat protein R911 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R911 PE=3 SV=1 99 496 8.0E-34
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 185 508 1.0E-33
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 51 512 2.0E-33
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 148 487 2.0E-33
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 83 332 3.0E-33
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 147 528 3.0E-33
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 148 487 3.0E-33
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 185 474 3.0E-33
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 120 395 4.0E-33
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 95 401 5.0E-33
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 144 485 6.0E-33
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 82 464 8.0E-33
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 181 509 9.0E-33
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 98 497 1.0E-32
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 251 510 2.0E-32
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 153 526 2.0E-32
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 45 512 2.0E-32
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 213 498 2.0E-32
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 156 429 2.0E-32
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 120 499 2.0E-32
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 251 510 3.0E-32
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 83 332 3.0E-32
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 45 512 3.0E-32
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 147 526 3.0E-32
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 172 499 3.0E-32
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 52 496 4.0E-32
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 83 493 4.0E-32
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 140 412 4.0E-32
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 83 496 5.0E-32
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 51 501 1.0E-31
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 83 371 1.0E-31
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 147 526 1.0E-31
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 98 497 1.0E-31
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 83 493 1.0E-31
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 52 496 2.0E-31
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 184 464 2.0E-31
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 145 430 2.0E-31
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 56 369 2.0E-31
sp|Q5UR04|YR911_MIMIV Putative ankyrin repeat protein R911 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R911 PE=3 SV=1 91 496 2.0E-31
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 81 430 2.0E-31
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 87 493 2.0E-31
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 147 487 3.0E-31
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 53 489 3.0E-31
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 83 486 6.0E-31
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 176 498 6.0E-31
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 53 369 7.0E-31
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 147 487 7.0E-31
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 185 429 7.0E-31
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 52 498 8.0E-31
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 55 496 9.0E-31
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 6 364 1.0E-30
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 181 509 1.0E-30
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 81 430 1.0E-30
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 131 513 2.0E-30
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 147 505 2.0E-30
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 98 497 2.0E-30
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 92 497 3.0E-30
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 50 553 3.0E-30
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 181 509 3.0E-30
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 51 508 4.0E-30
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 147 505 4.0E-30
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 178 432 5.0E-30
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 92 497 6.0E-30
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 64 462 6.0E-30
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 82 430 6.0E-30
sp|Q5UQJ2|YR863_MIMIV Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 63 465 7.0E-30
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 112 374 8.0E-30
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 85 401 9.0E-30
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 54 506 1.0E-29
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 251 496 1.0E-29
sp|Q5URB9|YR840_MIMIV Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 117 509 1.0E-29
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 120 512 1.0E-29
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 201 507 1.0E-29
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 82 430 1.0E-29
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 83 553 2.0E-29
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 83 553 2.0E-29
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 54 563 3.0E-29
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 83 456 3.0E-29
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 82 429 3.0E-29
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 26 429 4.0E-29
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 52 429 4.0E-29
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 237 508 6.0E-29
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 51 516 7.0E-29
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 237 498 8.0E-29
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 144 430 8.0E-29
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 114 429 9.0E-29
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 50 369 1.0E-28
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 159 498 1.0E-28
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 85 396 1.0E-28
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 145 464 1.0E-28
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 237 498 2.0E-28
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 159 498 2.0E-28
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 110 496 2.0E-28
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 144 430 2.0E-28
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 53 495 2.0E-28
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 53 495 2.0E-28
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 103 511 3.0E-28
sp|A2AS55|ANR16_MOUSE Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 142 462 3.0E-28
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 51 564 3.0E-28
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 86 429 5.0E-28
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 234 527 5.0E-28
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 82 496 5.0E-28
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 246 456 5.0E-28
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 102 429 6.0E-28
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 222 544 6.0E-28
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 222 544 6.0E-28
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 237 498 8.0E-28
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 253 545 8.0E-28
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 128 498 8.0E-28
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 142 460 8.0E-28
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 50 429 9.0E-28
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 152 416 1.0E-27
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 83 496 1.0E-27
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 50 480 1.0E-27
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 152 416 1.0E-27
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 152 416 1.0E-27
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 246 473 1.0E-27
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 152 416 2.0E-27
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 129 406 2.0E-27
sp|Q5UR04|YR911_MIMIV Putative ankyrin repeat protein R911 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R911 PE=3 SV=1 48 367 2.0E-27
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 104 342 2.0E-27
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 138 396 2.0E-27
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 152 498 2.0E-27
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 86 496 2.0E-27
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 82 430 2.0E-27
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 40 358 3.0E-27
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 80 563 3.0E-27
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 147 498 3.0E-27
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 86 525 3.0E-27
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 168 446 3.0E-27
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 86 499 3.0E-27
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 182 521 3.0E-27
sp|Q5UPE2|YL063_MIMIV Putative ankyrin repeat protein L63 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L63 PE=3 SV=1 105 367 3.0E-27
sp|Q5UR87|YR634_MIMIV Putative ankyrin repeat protein R634 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R634 PE=3 SV=1 62 401 3.0E-27
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 86 497 4.0E-27
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 40 336 4.0E-27
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 172 496 4.0E-27
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 145 515 4.0E-27
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 110 499 5.0E-27
sp|Q5UPA0|YL025_MIMIV Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 148 495 5.0E-27
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 83 429 6.0E-27
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 83 496 6.0E-27
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 51 497 7.0E-27
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 51 497 7.0E-27
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 145 345 7.0E-27
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 110 430 7.0E-27
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 160 496 7.0E-27
sp|A6NHY2|AKD1B_HUMAN Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 182 511 7.0E-27
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 2 417 8.0E-27
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 189 496 8.0E-27
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 182 487 9.0E-27
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 83 499 9.0E-27
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 209 495 1.0E-26
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 93 423 1.0E-26
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 182 486 1.0E-26
sp|Q5UQF1|YL483_MIMIV Putative ankyrin repeat protein L483 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L483 PE=3 SV=1 116 406 1.0E-26
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 91 484 1.0E-26
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 50 465 2.0E-26
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 145 345 2.0E-26
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 189 496 2.0E-26
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 144 400 2.0E-26
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 187 505 2.0E-26
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 117 407 2.0E-26
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 149 398 2.0E-26
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 197 491 2.0E-26
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 208 544 2.0E-26
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 237 496 3.0E-26
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 185 417 3.0E-26
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 187 505 3.0E-26
sp|Q5UQZ7|YR901_MIMIV Putative ankyrin repeat protein R901 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R901 PE=3 SV=1 117 406 3.0E-26
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 83 497 4.0E-26
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 244 473 4.0E-26
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 104 340 4.0E-26
sp|Q5UQJ2|YR863_MIMIV Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 48 341 5.0E-26
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 184 496 7.0E-26
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 185 421 7.0E-26
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 259 543 8.0E-26
sp|Q5UPA0|YL025_MIMIV Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 71 408 8.0E-26
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 118 401 8.0E-26
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 53 419 9.0E-26
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 253 571 1.0E-25
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 51 298 1.0E-25
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 93 405 1.0E-25
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 182 496 1.0E-25
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 151 398 1.0E-25
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 214 491 1.0E-25
sp|Q5UP39|YR873_MIMIV Putative ankyrin repeat protein R873 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R873 PE=3 SV=1 88 496 1.0E-25
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 222 544 1.0E-25
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 50 318 2.0E-25
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 147 496 2.0E-25
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 122 401 2.0E-25
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 188 491 2.0E-25
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 145 431 2.0E-25
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 131 401 2.0E-25
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 111 496 3.0E-25
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 246 499 3.0E-25
sp|Q5UQF1|YL483_MIMIV Putative ankyrin repeat protein L483 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L483 PE=3 SV=1 117 406 3.0E-25
sp|Q8VHS6|ASB15_MOUSE Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 204 487 3.0E-25
sp|Q5UQ08|YR787_MIMIV Putative ankyrin repeat protein R787 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R787 PE=3 SV=1 80 406 3.0E-25
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 96 484 3.0E-25
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 244 495 3.0E-25
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 271 498 4.0E-25
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 86 362 4.0E-25
sp|Q5UPA0|YL025_MIMIV Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 65 362 4.0E-25
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 83 497 5.0E-25
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 96 401 5.0E-25
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 77 372 6.0E-25
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 86 433 6.0E-25
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 120 439 6.0E-25
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 78 525 7.0E-25
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 180 388 7.0E-25
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 180 388 7.0E-25
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 2 416 8.0E-25
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 106 403 9.0E-25
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 46 334 9.0E-25
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 213 429 1.0E-24
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 128 401 1.0E-24
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 144 429 1.0E-24
sp|A6NHY2|AKD1B_HUMAN Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 147 430 1.0E-24
sp|Q5UQF1|YL483_MIMIV Putative ankyrin repeat protein L483 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L483 PE=3 SV=1 83 371 1.0E-24
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 31 329 1.0E-24
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 93 405 1.0E-24
sp|Q5UP39|YR873_MIMIV Putative ankyrin repeat protein R873 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R873 PE=3 SV=1 120 431 1.0E-24
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 143 471 1.0E-24
sp|Q499M5|ANR16_RAT Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 142 462 1.0E-24
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 143 471 1.0E-24
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 147 498 2.0E-24
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 86 506 2.0E-24
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 277 496 2.0E-24
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 115 362 2.0E-24
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 186 505 2.0E-24
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 110 430 2.0E-24
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 50 498 2.0E-24
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 53 420 3.0E-24
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 83 341 3.0E-24
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 53 420 3.0E-24
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 31 329 3.0E-24
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 50 498 3.0E-24
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 117 412 3.0E-24
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 271 505 4.0E-24
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 271 505 4.0E-24
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 83 497 4.0E-24
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 85 335 4.0E-24
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 77 372 4.0E-24
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 96 401 4.0E-24
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 177 408 4.0E-24
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 240 496 5.0E-24
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 85 401 5.0E-24
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 185 434 5.0E-24
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 92 416 5.0E-24
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 218 499 6.0E-24
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 55 509 6.0E-24
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 143 471 6.0E-24
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 189 496 7.0E-24
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 243 496 7.0E-24
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 45 496 9.0E-24
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 50 416 1.0E-23
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 77 400 1.0E-23
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 172 479 1.0E-23
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 152 406 1.0E-23
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 187 505 1.0E-23
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 114 430 1.0E-23
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 98 401 1.0E-23
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 143 498 1.0E-23
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 58 370 2.0E-23
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 144 429 2.0E-23
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 185 434 2.0E-23
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 50 498 2.0E-23
sp|Q9Z2G0|FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 111 298 2.0E-23
sp|P0C6P7|FEM1B_RAT Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 111 298 2.0E-23
sp|Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 111 298 2.0E-23
sp|Q5UP11|YR848_MIMIV Putative ankyrin repeat protein R848 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R848 PE=3 SV=1 107 336 2.0E-23
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 177 495 2.0E-23
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 180 428 2.0E-23
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 89 421 2.0E-23
sp|Q9J507|V228_FOWPN Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 120 451 2.0E-23
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 213 428 2.0E-23
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 244 464 3.0E-23
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 192 384 3.0E-23
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 213 428 3.0E-23
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 213 428 3.0E-23
sp|Q5UQJ2|YR863_MIMIV Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 158 496 4.0E-23
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 128 383 4.0E-23
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 128 383 4.0E-23
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 117 524 5.0E-23
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 77 453 6.0E-23
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 144 321 6.0E-23
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 140 329 6.0E-23
sp|Q5ZM55|FEM1B_CHICK Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 109 305 6.0E-23
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 114 411 6.0E-23
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 229 496 7.0E-23
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 211 498 7.0E-23
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 149 399 7.0E-23
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 119 431 7.0E-23
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 213 441 7.0E-23
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 236 432 8.0E-23
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 50 499 9.0E-23
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 115 380 9.0E-23
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 229 496 1.0E-22
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 181 495 1.0E-22
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 105 428 1.0E-22
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 238 446 1.0E-22
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 244 495 1.0E-22
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 189 496 2.0E-22
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 123 429 2.0E-22
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 144 496 2.0E-22
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 152 429 2.0E-22
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 115 334 2.0E-22
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 244 495 2.0E-22
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 238 477 2.0E-22
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 147 432 2.0E-22
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 238 445 2.0E-22
sp|Q5UPH0|YL100_MIMIV Putative ankyrin repeat protein L100 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L100 PE=3 SV=1 43 381 2.0E-22
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 211 506 3.0E-22
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 189 496 3.0E-22
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 90 384 3.0E-22
sp|Q8VHS6|ASB15_MOUSE Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 144 429 3.0E-22
sp|Q5UPG7|YL091_MIMIV Putative ankyrin repeat protein L91 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L91 PE=3 SV=1 169 483 3.0E-22
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 147 432 3.0E-22
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 117 380 3.0E-22
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 145 447 3.0E-22
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 50 465 4.0E-22
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 145 365 4.0E-22
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 158 486 4.0E-22
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 143 383 4.0E-22
sp|Q5UP11|YR848_MIMIV Putative ankyrin repeat protein R848 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R848 PE=3 SV=1 136 379 4.0E-22
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 255 496 5.0E-22
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 128 383 5.0E-22
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 238 477 5.0E-22
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 238 445 5.0E-22
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 145 447 5.0E-22
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 90 409 6.0E-22
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 90 386 6.0E-22
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 103 463 6.0E-22
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 115 437 6.0E-22
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 238 446 6.0E-22
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 193 470 6.0E-22
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 238 476 6.0E-22
sp|A2AS55|ANR16_MOUSE Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 50 333 7.0E-22
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 115 437 7.0E-22
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 130 328 7.0E-22
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 115 437 7.0E-22
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 143 471 7.0E-22
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 178 416 8.0E-22
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 238 445 8.0E-22
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 225 505 9.0E-22
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 240 496 9.0E-22
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 77 453 9.0E-22
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 115 437 9.0E-22
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 267 480 9.0E-22
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 51 317 1.0E-21
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 262 496 1.0E-21
sp|Q5UQZ7|YR901_MIMIV Putative ankyrin repeat protein R901 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R901 PE=3 SV=1 152 442 1.0E-21
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 120 430 1.0E-21
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 200 401 1.0E-21
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 167 362 1.0E-21
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 149 432 1.0E-21
sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 120 439 1.0E-21
sp|Q9J5H7|V024_FOWPN Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 115 481 1.0E-21
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 238 446 1.0E-21
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 217 446 1.0E-21
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 267 480 1.0E-21
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 267 480 1.0E-21
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 238 445 1.0E-21
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 53 368 2.0E-21
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 103 463 2.0E-21
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 116 366 2.0E-21
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 147 362 2.0E-21
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 238 445 2.0E-21
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 238 446 2.0E-21
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 171 430 2.0E-21
sp|Q9VFD5|FEM1A_DROME Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 240 432 2.0E-21
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 238 480 2.0E-21
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 243 432 2.0E-21
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 238 445 2.0E-21
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 143 498 2.0E-21
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 177 408 2.0E-21
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 145 387 3.0E-21
sp|A6NHY2|AKD1B_HUMAN Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 104 398 3.0E-21
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 86 536 3.0E-21
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 98 347 3.0E-21
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 238 446 3.0E-21
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 120 439 3.0E-21
sp|Q8N9B4|ANR42_HUMAN Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 168 457 3.0E-21
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 182 362 3.0E-21
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 143 437 3.0E-21
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 257 496 4.0E-21
sp|Q9VFD5|FEM1A_DROME Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 133 331 4.0E-21
sp|Q5UPJ9|YL122_MIMIV Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 65 429 4.0E-21
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 238 445 4.0E-21
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 52 463 5.0E-21
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 145 502 5.0E-21
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 255 496 5.0E-21
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 267 480 5.0E-21
sp|Q5RCK5|ASB7_PONAB Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 174 416 5.0E-21
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 211 476 5.0E-21
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 238 480 5.0E-21
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 238 480 5.0E-21
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 238 446 6.0E-21
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 52 298 7.0E-21
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 246 471 7.0E-21
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 248 509 7.0E-21
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 117 413 7.0E-21
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 101 499 7.0E-21
sp|Q9H672|ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 182 416 7.0E-21
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 248 509 8.0E-21
sp|Q9BGT9|ASB7_MACFA Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 182 416 8.0E-21
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 238 445 8.0E-21
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 144 483 8.0E-21
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 107 397 9.0E-21
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 114 371 9.0E-21
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 140 328 9.0E-21
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 53 368 1.0E-20
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 51 331 1.0E-20
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 246 471 1.0E-20
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 269 496 1.0E-20
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 176 495 1.0E-20
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 115 297 1.0E-20
sp|Q6GPE5|FEM1B_XENLA Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 109 305 1.0E-20
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 238 480 1.0E-20
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 238 445 1.0E-20
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 117 524 1.0E-20
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 211 508 2.0E-20
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 149 508 2.0E-20
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 284 509 2.0E-20
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 53 512 2.0E-20
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 115 285 2.0E-20
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 144 429 2.0E-20
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 238 445 2.0E-20
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 115 366 2.0E-20
sp|Q9J5H7|V024_FOWPN Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 180 484 2.0E-20
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 147 366 2.0E-20
sp|Q09YN0|ASZ1_RABIT Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 124 296 2.0E-20
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 215 428 2.0E-20
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 53 368 3.0E-20
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 262 496 3.0E-20
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 115 366 3.0E-20
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 149 366 3.0E-20
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 147 366 3.0E-20
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 147 362 3.0E-20
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 101 498 3.0E-20
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 147 362 3.0E-20
sp|Q9BSK4|FEM1A_HUMAN Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 244 435 3.0E-20
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 182 362 3.0E-20
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 53 300 4.0E-20
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 178 496 4.0E-20
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 160 365 4.0E-20
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 197 399 4.0E-20
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 97 395 4.0E-20
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 117 400 5.0E-20
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 101 497 5.0E-20
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 149 366 5.0E-20
sp|Q5UPE3|YL062_MIMIV Putative ankyrin repeat protein L62 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L62 PE=3 SV=1 115 363 5.0E-20
sp|Q8VD46|ASZ1_MOUSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 124 296 5.0E-20
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 283 513 6.0E-20
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 97 487 6.0E-20
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 299 529 6.0E-20
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 144 332 6.0E-20
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 116 432 6.0E-20
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 147 427 6.0E-20
sp|Q9BSK4|FEM1A_HUMAN Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 115 299 6.0E-20
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 115 366 6.0E-20
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 86 350 6.0E-20
sp|Q9J516|V219_FOWPN Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 188 467 6.0E-20
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 115 366 6.0E-20
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 115 366 6.0E-20
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 238 407 7.0E-20
sp|Q9TXQ1|TNKS1_CAEEL Tankyrase-like protein OS=Caenorhabditis elegans GN=tank-1 PE=2 SV=1 147 480 7.0E-20
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 107 397 8.0E-20
sp|Q9J5H9|V022_FOWPN Putative ankyrin repeat protein FPV022 OS=Fowlpox virus (strain NVSL) GN=FPV022 PE=3 SV=1 116 450 8.0E-20
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 238 445 8.0E-20
sp|Q9J513|V222_FOWPN Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 161 395 8.0E-20
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 55 290 9.0E-20
sp|Q29RM5|FEM1A_BOVIN Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 244 430 9.0E-20
sp|Q9Z2G1|FM1AA_MOUSE Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 244 433 9.0E-20
sp|Q4V890|FEM1A_RAT Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 244 433 9.0E-20
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 197 399 9.0E-20
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 43 466 1.0E-19
sp|Q499M5|ANR16_RAT Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 41 333 1.0E-19
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 267 480 1.0E-19
sp|Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 215 462 1.0E-19
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 120 333 1.0E-19
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 147 366 1.0E-19
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 200 401 1.0E-19
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 83 263 1.0E-19
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 86 334 1.0E-19
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 238 445 1.0E-19
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 238 480 1.0E-19
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 238 480 1.0E-19
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 197 399 1.0E-19
sp|A0M8T3|ASZ1_FELCA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 124 296 1.0E-19
sp|Q96AX9|MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 145 451 1.0E-19
sp|Q8VHS5|ASB16_MOUSE Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 247 430 1.0E-19
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 238 445 1.0E-19
sp|Q07E17|ASZ1_MUSPF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 124 296 1.0E-19
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 51 272 2.0E-19
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 83 370 2.0E-19
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 281 500 2.0E-19
sp|Q5UQZ7|YR901_MIMIV Putative ankyrin repeat protein R901 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R901 PE=3 SV=1 46 320 2.0E-19
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 269 513 2.0E-19
sp|Q9Z2G0|FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 215 447 2.0E-19
sp|P0C6P7|FEM1B_RAT Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 215 447 2.0E-19
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 246 459 2.0E-19
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 115 296 2.0E-19
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 115 296 2.0E-19
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 120 333 2.0E-19
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 115 296 2.0E-19
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 120 333 2.0E-19
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 117 366 2.0E-19
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 120 329 2.0E-19
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 90 397 2.0E-19
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 200 401 2.0E-19
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 122 383 2.0E-19
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 147 432 2.0E-19
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 147 366 2.0E-19
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 147 366 2.0E-19
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 116 432 2.0E-19
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 277 466 2.0E-19
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 246 446 2.0E-19
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 115 395 2.0E-19
sp|Q29RM5|FEM1A_BOVIN Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 115 299 2.0E-19
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 144 349 2.0E-19
sp|Q07E30|ASZ1_NEONE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 124 296 2.0E-19
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 182 417 2.0E-19
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 269 512 3.0E-19
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 257 496 3.0E-19
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 79 330 3.0E-19
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 153 497 3.0E-19
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 149 362 3.0E-19
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 168 385 3.0E-19
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 115 395 3.0E-19
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 234 428 3.0E-19
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 115 366 3.0E-19
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 144 349 3.0E-19
sp|Q2IBB4|ASZ1_RHIFE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 124 296 3.0E-19
sp|Q9J5I7|V014_FOWPN Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 94 299 3.0E-19
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 211 412 3.0E-19
sp|Q8C0T1|FM1AB_MOUSE Protein fem-1 homolog A-B OS=Mus musculus GN=Fem1ab PE=2 SV=1 244 430 3.0E-19
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 124 296 3.0E-19
sp|Q8WMX8|ASZ1_BOVIN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 116 296 3.0E-19
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 77 364 4.0E-19
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 48 300 4.0E-19
sp|Q5ZM55|FEM1B_CHICK Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 215 433 4.0E-19
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 200 401 4.0E-19
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 50 316 4.0E-19
sp|Q9J513|V222_FOWPN Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 82 496 4.0E-19
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 147 366 4.0E-19
sp|Q8C0T1|FM1AB_MOUSE Protein fem-1 homolog A-B OS=Mus musculus GN=Fem1ab PE=2 SV=1 115 299 4.0E-19
sp|Q09YI3|ASZ1_SHEEP Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 116 296 4.0E-19
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 168 385 5.0E-19
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 257 496 6.0E-19
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 83 392 6.0E-19
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 83 374 6.0E-19
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 196 401 6.0E-19
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 83 263 6.0E-19
sp|Q07E43|ASZ1_DASNO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 124 296 6.0E-19
sp|Q108U1|ASZ1_LOXAF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 124 296 6.0E-19
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 86 265 7.0E-19
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 50 362 7.0E-19
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 168 385 7.0E-19
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 144 349 7.0E-19
sp|A4D7T3|ASZ1_MACEU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 124 296 7.0E-19
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 243 417 7.0E-19
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 254 496 8.0E-19
sp|Q5UPA0|YL025_MIMIV Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 23 329 8.0E-19
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 115 268 8.0E-19
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 149 366 8.0E-19
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 180 376 8.0E-19
sp|Q5UP14|YR845_MIMIV Putative ankyrin repeat protein R845 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R845 PE=3 SV=1 128 367 8.0E-19
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 247 487 9.0E-19
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 115 264 9.0E-19
sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 246 508 9.0E-19
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 50 362 1.0E-18
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 50 362 1.0E-18
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 55 290 1.0E-18
sp|Q5UQF1|YL483_MIMIV Putative ankyrin repeat protein L483 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L483 PE=3 SV=1 9 301 1.0E-18
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 281 500 1.0E-18
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 190 409 1.0E-18
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 190 409 1.0E-18
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 65 358 1.0E-18
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 147 366 1.0E-18
sp|Q9VFD5|FEM1A_DROME Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 178 363 1.0E-18
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 120 332 1.0E-18
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 115 366 1.0E-18
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 115 264 1.0E-18
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 115 264 1.0E-18
sp|Q9BSK4|FEM1A_HUMAN Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 145 332 1.0E-18
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 144 401 1.0E-18
sp|Q4V890|FEM1A_RAT Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 115 299 1.0E-18
sp|Q2QLA4|ASZ1_HORSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 124 296 1.0E-18
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 182 417 1.0E-18
sp|Q5UPU4|YR267_MIMIV Putative ankyrin repeat protein R267 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R267 PE=3 SV=1 120 364 1.0E-18
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 180 376 1.0E-18
sp|Q2QLH1|ASZ1_OTOGA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Otolemur garnettii GN=ASZ1 PE=3 SV=1 124 296 1.0E-18
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 215 416 1.0E-18
sp|Q07DY6|ASZ1_COLGU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 124 296 1.0E-18
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 53 251 2.0E-18
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 335 496 2.0E-18
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 83 399 2.0E-18
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 83 392 2.0E-18
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 83 374 2.0E-18
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 193 496 2.0E-18
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 95 285 2.0E-18
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 226 427 2.0E-18
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 234 428 2.0E-18
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 152 365 2.0E-18
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 234 428 2.0E-18
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 83 263 2.0E-18
sp|Q9Z2G1|FM1AA_MOUSE Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 115 299 2.0E-18
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 211 412 2.0E-18
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 277 456 2.0E-18
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 226 416 2.0E-18
sp|Q09YJ5|ASZ1_MUNMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 116 292 2.0E-18
sp|Q09YK6|ASZ1_ATEGE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ateles geoffroyi GN=ASZ1 PE=3 SV=1 145 296 2.0E-18
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 277 469 2.0E-18
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 144 352 2.0E-18
sp|Q2QL84|ASZ1_MICMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 124 296 2.0E-18
sp|A1X154|ASZ1_ECHTE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 124 296 2.0E-18
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 82 351 3.0E-18
sp|Q5UP39|YR873_MIMIV Putative ankyrin repeat protein R873 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R873 PE=3 SV=1 46 340 3.0E-18
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 97 487 3.0E-18
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 82 296 3.0E-18
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 115 264 3.0E-18
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 180 432 3.0E-18
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 108 358 3.0E-18
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 244 416 3.0E-18
sp|Q07DX6|ASZ1_NOMLE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 124 296 3.0E-18
sp|Q8WWH4|ASZ1_HUMAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 124 296 3.0E-18
sp|Q91ZU0|ASB7_MOUSE Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 149 416 3.0E-18
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 51 297 4.0E-18
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 51 297 4.0E-18
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 48 271 4.0E-18
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 82 333 4.0E-18
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 180 399 4.0E-18
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 83 387 4.0E-18
sp|Q2IBF5|ASZ1_GORGO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 124 296 4.0E-18
sp|Q95N27|PP16B_BOVIN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 136 370 4.0E-18
sp|Q2IBB1|ASZ1_CHLAE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 124 296 4.0E-18
sp|Q8WMX6|ASZ1_PANTR Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 124 296 4.0E-18
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 269 512 5.0E-18
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 65 358 5.0E-18
sp|Q5UPJ9|YL122_MIMIV Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 156 498 5.0E-18
sp|Q8WMX7|ASZ1_PAPAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 124 296 5.0E-18
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 51 433 5.0E-18
sp|Q96T49|PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 136 370 5.0E-18
sp|Q3KP44|ANR55_HUMAN Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 206 507 5.0E-18
sp|Q2IBE3|ASZ1_PONAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 124 296 5.0E-18
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 50 416 6.0E-18
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 310 512 6.0E-18
sp|A6NHY2|AKD1B_HUMAN Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 79 331 6.0E-18
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 82 296 6.0E-18
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 115 264 6.0E-18
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 149 332 6.0E-18
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 251 480 6.0E-18
sp|Q6ZVH7|ESPNL_HUMAN Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 119 421 6.0E-18
sp|Q8VHQ3|PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=1 SV=1 136 370 6.0E-18
sp|Q2IBG0|ASZ1_EULMM Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 124 296 6.0E-18
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 46 281 7.0E-18
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 115 341 7.0E-18
sp|Q5UP19|YR864_MIMIV Putative ankyrin repeat protein R864 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L864 PE=3 SV=1 123 341 7.0E-18
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 50 388 8.0E-18
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 141 347 8.0E-18
sp|Q2QLC6|ASZ1_CARPS Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 124 292 8.0E-18
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 126 513 9.0E-18
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 313 527 9.0E-18
sp|A4D7T3|ASZ1_MACEU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 206 406 9.0E-18
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 160 365 9.0E-18
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 98 384 1.0E-17
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 50 362 1.0E-17
sp|Q8VHS6|ASB15_MOUSE Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 83 411 1.0E-17
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 44 396 1.0E-17
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 242 464 1.0E-17
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 255 462 1.0E-17
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 83 416 1.0E-17
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 115 264 1.0E-17
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 200 447 1.0E-17
sp|Q4V890|FEM1A_RAT Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 145 331 1.0E-17
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 276 480 1.0E-17
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 276 480 1.0E-17
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 115 264 1.0E-17
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 183 395 1.0E-17
sp|Q96I34|PP16A_HUMAN Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens GN=PPP1R16A PE=1 SV=1 152 395 1.0E-17
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 146 425 1.0E-17
sp|Q5UPE2|YL063_MIMIV Putative ankyrin repeat protein L63 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L63 PE=3 SV=1 117 529 2.0E-17
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 18 299 2.0E-17
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 169 391 2.0E-17
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 169 391 2.0E-17
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 82 300 2.0E-17
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 244 532 2.0E-17
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 82 300 2.0E-17
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 182 416 2.0E-17
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 149 332 2.0E-17
sp|Q9Z2G1|FM1AA_MOUSE Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 145 331 2.0E-17
sp|A0M8T3|ASZ1_FELCA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 251 428 2.0E-17
sp|Q8C0T1|FM1AB_MOUSE Protein fem-1 homolog A-B OS=Mus musculus GN=Fem1ab PE=2 SV=1 145 331 2.0E-17
sp|Q5UP14|YR845_MIMIV Putative ankyrin repeat protein R845 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R845 PE=3 SV=1 160 400 2.0E-17
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 160 365 2.0E-17
sp|Q9BZL4|PP12C_HUMAN Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens GN=PPP1R12C PE=1 SV=1 243 418 2.0E-17
sp|A1ZBY1|FEM1B_DROME Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 246 434 2.0E-17
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 208 415 2.0E-17
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 83 433 2.0E-17
sp|Q923M0|PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 152 395 2.0E-17
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 50 271 3.0E-17
sp|Q5UPE2|YL063_MIMIV Putative ankyrin repeat protein L63 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L63 PE=3 SV=1 248 504 3.0E-17
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 50 362 3.0E-17
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 82 300 3.0E-17
sp|Q9VFD5|FEM1A_DROME Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 261 496 3.0E-17
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 102 355 3.0E-17
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 82 296 3.0E-17
sp|Q6ZVH7|ESPNL_HUMAN Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 250 538 3.0E-17
sp|Q6NLQ8|XB32_ARATH E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 161 416 3.0E-17
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 243 420 3.0E-17
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 51 386 4.0E-17
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 26 297 4.0E-17
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 178 362 4.0E-17
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 82 300 4.0E-17
sp|Q6GPE5|FEM1B_XENLA Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 215 429 4.0E-17
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 276 480 4.0E-17
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 146 365 4.0E-17
sp|Q9Z2G0|FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 180 363 5.0E-17
sp|P0C6P7|FEM1B_RAT Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 180 363 5.0E-17
sp|Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 180 363 5.0E-17
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 242 464 5.0E-17
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 115 264 5.0E-17
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 243 416 5.0E-17
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 82 300 5.0E-17
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 177 376 5.0E-17
sp|Q337A0|XB33_ORYSJ Probable E3 ubiquitin-protein ligase XBOS33 OS=Oryza sativa subsp. japonica GN=XBOS33 PE=2 SV=1 213 416 5.0E-17
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 242 464 6.0E-17
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 115 535 6.0E-17
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 82 300 6.0E-17
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 144 301 6.0E-17
sp|Q9Y6X6|MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 191 402 6.0E-17
sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 218 419 6.0E-17
sp|Q5UPX1|YL289_MIMIV Putative ankyrin repeat protein L289 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L289 PE=3 SV=1 189 486 6.0E-17
sp|Q5ZM55|FEM1B_CHICK Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 180 363 7.0E-17
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 255 428 7.0E-17
sp|Q07DV3|ASZ1_AOTNA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 145 296 7.0E-17
sp|Q2QLB5|ASZ1_CALMO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callicebus moloch GN=ASZ1 PE=3 SV=1 174 362 7.0E-17
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 82 296 8.0E-17
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 55 233 8.0E-17
sp|Q07E43|ASZ1_DASNO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 255 428 8.0E-17
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 269 512 9.0E-17
sp|Q5UP39|YR873_MIMIV Putative ankyrin repeat protein R873 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R873 PE=3 SV=1 248 512 9.0E-17
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 53 341 9.0E-17
sp|Q9J513|V222_FOWPN Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 119 482 9.0E-17
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 193 398 9.0E-17
sp|Q5UP19|YR864_MIMIV Putative ankyrin repeat protein R864 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L864 PE=3 SV=1 186 406 9.0E-17
sp|Q3UMT1|PP12C_MOUSE Protein phosphatase 1 regulatory subunit 12C OS=Mus musculus GN=Ppp1r12c PE=1 SV=1 243 418 9.0E-17
sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 206 552 9.0E-17
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 62 529 1.0E-16
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 115 416 1.0E-16
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 211 485 1.0E-16
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 149 395 1.0E-16
sp|A0M8T3|ASZ1_FELCA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 152 329 1.0E-16
sp|Q07E17|ASZ1_MUSPF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 152 329 1.0E-16
sp|Q07E30|ASZ1_NEONE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 152 329 1.0E-16
sp|Q2QLA4|ASZ1_HORSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 255 428 1.0E-16
sp|Q07DX6|ASZ1_NOMLE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 152 329 1.0E-16
sp|Q8WWH4|ASZ1_HUMAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 152 329 1.0E-16
sp|Q2IBF5|ASZ1_GORGO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 152 329 1.0E-16
sp|Q2IBB1|ASZ1_CHLAE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 152 329 1.0E-16
sp|Q8WMX6|ASZ1_PANTR Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 152 329 1.0E-16
sp|Q8WMX7|ASZ1_PAPAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 152 329 1.0E-16
sp|Q5UP19|YR864_MIMIV Putative ankyrin repeat protein R864 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L864 PE=3 SV=1 152 373 1.0E-16
sp|Q2QLB5|ASZ1_CALMO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callicebus moloch GN=ASZ1 PE=3 SV=1 124 296 1.0E-16
sp|Q9J5H5|V026_FOWPN Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 305 496 1.0E-16
sp|Q09YH1|ASZ1_SAIBB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 145 296 1.0E-16
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 152 347 1.0E-16
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 173 396 1.0E-16
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 127 328 1.0E-16
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 104 398 2.0E-16
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 124 535 2.0E-16
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 82 308 2.0E-16
sp|Q09YN0|ASZ1_RABIT Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 152 329 2.0E-16
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 145 329 2.0E-16
sp|Q07E17|ASZ1_MUSPF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 251 428 2.0E-16
sp|Q2IBB4|ASZ1_RHIFE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 255 428 2.0E-16
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 152 329 2.0E-16
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 160 365 2.0E-16
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 260 496 2.0E-16
sp|Q2QLG0|ASZ1_CALJA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 145 296 2.0E-16
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 159 366 2.0E-16
sp|Q6KAE5|XB32_ORYSJ Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 117 362 2.0E-16
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 115 529 3.0E-16
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 103 332 3.0E-16
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 243 416 3.0E-16
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 82 300 3.0E-16
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 46 352 3.0E-16
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 103 316 3.0E-16
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 82 296 3.0E-16
sp|Q108U1|ASZ1_LOXAF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 152 329 3.0E-16
sp|Q2QLH1|ASZ1_OTOGA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Otolemur garnettii GN=ASZ1 PE=3 SV=1 255 428 3.0E-16
sp|Q07DY6|ASZ1_COLGU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 255 428 3.0E-16
sp|Q07DX6|ASZ1_NOMLE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 255 428 3.0E-16
sp|Q2IBF5|ASZ1_GORGO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 255 428 3.0E-16
sp|Q8WMX6|ASZ1_PANTR Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 255 428 3.0E-16
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 128 385 3.0E-16
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 128 328 3.0E-16
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 226 429 3.0E-16
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 168 402 3.0E-16
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 152 347 3.0E-16
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 50 429 4.0E-16
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 281 492 4.0E-16
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 82 300 4.0E-16
sp|Q09YI3|ASZ1_SHEEP Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 152 329 4.0E-16
sp|Q108U1|ASZ1_LOXAF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 174 362 4.0E-16
sp|Q108U1|ASZ1_LOXAF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 255 428 4.0E-16
sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 115 366 4.0E-16
sp|Q2IBG0|ASZ1_EULMM Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 142 329 4.0E-16
sp|Q2QLB5|ASZ1_CALMO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callicebus moloch GN=ASZ1 PE=3 SV=1 152 329 4.0E-16
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 115 334 4.0E-16
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 147 340 4.0E-16
sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 217 419 4.0E-16
sp|Q5UQY9|YR896_MIMIV Putative ankyrin repeat protein R896 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R896 PE=3 SV=1 248 429 4.0E-16
sp|Q6DRG7|MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 218 473 4.0E-16
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 77 468 5.0E-16
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 50 429 5.0E-16
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 82 296 5.0E-16
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 82 233 5.0E-16
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 82 233 5.0E-16
sp|Q6GPE5|FEM1B_XENLA Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 147 368 5.0E-16
sp|Q07E30|ASZ1_NEONE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 255 428 5.0E-16
sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 217 455 5.0E-16
sp|O60237|MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens GN=PPP1R12B PE=1 SV=2 255 418 5.0E-16
sp|Q07DZ7|ASZ1_ORNAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 145 296 5.0E-16
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 52 335 6.0E-16
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 232 500 6.0E-16
sp|Q5UPH0|YL100_MIMIV Putative ankyrin repeat protein L100 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L100 PE=3 SV=1 182 456 6.0E-16
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 173 423 6.0E-16
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 82 233 6.0E-16
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 82 300 6.0E-16
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 82 300 6.0E-16
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 82 300 6.0E-16
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 145 329 6.0E-16
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 178 380 6.0E-16
sp|Q2QL84|ASZ1_MICMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 152 329 6.0E-16
sp|Q8WWH4|ASZ1_HUMAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 255 428 6.0E-16
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 82 300 7.0E-16
sp|Q09YI3|ASZ1_SHEEP Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 251 428 7.0E-16
sp|Q2QLH1|ASZ1_OTOGA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Otolemur garnettii GN=ASZ1 PE=3 SV=1 152 329 7.0E-16
sp|Q2IBB1|ASZ1_CHLAE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 255 428 7.0E-16
sp|Q8WMX7|ASZ1_PAPAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 255 428 7.0E-16
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 50 512 7.0E-16
sp|Q9J5H8|V023_FOWPN Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 256 481 7.0E-16
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 243 416 8.0E-16
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 102 341 8.0E-16
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 272 483 8.0E-16
sp|Q8VD46|ASZ1_MOUSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 152 329 8.0E-16
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 82 300 8.0E-16
sp|Q8WMX8|ASZ1_BOVIN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 255 428 8.0E-16
sp|Q8WMX8|ASZ1_BOVIN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 152 329 8.0E-16
sp|Q2QL84|ASZ1_MICMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 255 428 8.0E-16
sp|Q2IBE3|ASZ1_PONAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 152 329 8.0E-16
sp|Q6NLQ8|XB32_ARATH E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 117 317 8.0E-16
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 134 317 8.0E-16
sp|Q9Y6X6|MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 193 398 8.0E-16
sp|Q862Z2|ASB5_RABIT Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 115 334 8.0E-16
sp|Q10728|MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 217 419 8.0E-16
sp|Q5URB9|YR840_MIMIV Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 58 271 9.0E-16
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 40 241 9.0E-16
sp|Q5RCK5|ASB7_PONAB Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 38 335 9.0E-16
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 82 300 9.0E-16
sp|Q923M0|PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 44 269 9.0E-16
sp|Q07DZ7|ASZ1_ORNAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 260 421 9.0E-16
sp|Q8WWX0|ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 115 334 9.0E-16
sp|A6NHY2|AKD1B_HUMAN Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 42 299 1.0E-15
sp|Q5UQ08|YR787_MIMIV Putative ankyrin repeat protein R787 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R787 PE=3 SV=1 149 496 1.0E-15
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 82 300 1.0E-15
sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 211 500 1.0E-15
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 83 233 1.0E-15
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 145 533 1.0E-15
sp|Q8VD46|ASZ1_MOUSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 255 428 1.0E-15
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 115 379 1.0E-15
sp|Q07E43|ASZ1_DASNO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 152 329 1.0E-15
sp|A4D7T3|ASZ1_MACEU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 167 362 1.0E-15
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 145 329 1.0E-15
sp|Q2IBE3|ASZ1_PONAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 255 428 1.0E-15
sp|Q07DV3|ASZ1_AOTNA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 152 329 1.0E-15
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 291 498 1.0E-15
sp|Q5UPA2|YL023_MIMIV Putative ankyrin repeat protein L23 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L23 PE=3 SV=1 195 369 1.0E-15
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 291 498 1.0E-15
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 291 498 1.0E-15
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 291 498 1.0E-15
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 291 498 1.0E-15
sp|Q53RE8|ANR39_HUMAN Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 234 364 1.0E-15
sp|Q5UPD9|YL066_MIMIV Putative ankyrin repeat protein L66 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L66 PE=3 SV=1 116 495 1.0E-15
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 86 299 2.0E-15
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 40 241 2.0E-15
sp|Q5UQZ7|YR901_MIMIV Putative ankyrin repeat protein R901 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R901 PE=3 SV=1 248 500 2.0E-15
sp|Q9Z2G0|FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 270 510 2.0E-15
sp|P0C6P7|FEM1B_RAT Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 270 510 2.0E-15
sp|Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 270 510 2.0E-15
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 273 496 2.0E-15
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 145 296 2.0E-15
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 82 300 2.0E-15
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 247 487 2.0E-15
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 145 296 2.0E-15
sp|Q09YN0|ASZ1_RABIT Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 255 428 2.0E-15
sp|Q8VD46|ASZ1_MOUSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 174 362 2.0E-15
sp|Q96AX9|MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 11 385 2.0E-15
sp|Q09YJ5|ASZ1_MUNMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 255 424 2.0E-15
sp|Q09YJ5|ASZ1_MUNMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 152 325 2.0E-15
sp|A1X154|ASZ1_ECHTE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 174 362 2.0E-15
sp|A1X154|ASZ1_ECHTE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 208 406 2.0E-15
sp|Q2IBG0|ASZ1_EULMM Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 255 428 2.0E-15
sp|Q5UPA2|YL023_MIMIV Putative ankyrin repeat protein L23 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L23 PE=3 SV=1 120 270 2.0E-15
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 145 340 2.0E-15
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 309 516 2.0E-15
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 291 498 2.0E-15
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 107 394 2.0E-15
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 179 396 2.0E-15
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 291 498 2.0E-15
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 226 429 2.0E-15
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 164 496 3.0E-15
sp|Q9H672|ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 82 335 3.0E-15
sp|Q2IBB4|ASZ1_RHIFE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 152 329 3.0E-15
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 276 487 3.0E-15
sp|Q2QLA4|ASZ1_HORSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 152 329 3.0E-15
sp|Q5UPU4|YR267_MIMIV Putative ankyrin repeat protein R267 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R267 PE=3 SV=1 158 435 3.0E-15
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 183 395 3.0E-15
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 243 480 3.0E-15
sp|Q2IBB1|ASZ1_CHLAE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 189 362 3.0E-15
sp|Q8WMX7|ASZ1_PAPAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 189 362 3.0E-15
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 112 324 3.0E-15
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 266 480 3.0E-15
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 127 331 3.0E-15
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 223 421 3.0E-15
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 223 421 3.0E-15
sp|Q4JHE0|XB36_ORYSJ Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 97 284 3.0E-15
sp|Q4ULZ2|Y580_RICFE Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 194 413 3.0E-15
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 291 498 3.0E-15
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 291 498 3.0E-15
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 115 334 3.0E-15
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 46 352 4.0E-15
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 46 352 4.0E-15
sp|Q9VFD5|FEM1A_DROME Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 35 266 4.0E-15
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 211 500 4.0E-15
sp|Q9BGT9|ASB7_MACFA Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 82 335 4.0E-15
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 196 500 4.0E-15
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 193 398 4.0E-15
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 183 395 4.0E-15
sp|A1X154|ASZ1_ECHTE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 251 428 4.0E-15
sp|Q2IBE3|ASZ1_PONAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 189 362 4.0E-15
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 226 401 4.0E-15
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 266 570 4.0E-15
sp|Q8WWX0|ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 147 340 4.0E-15
sp|Q6AFL2|Y958_LEIXX Putative ankyrin-containing lipoprotein Lxx09580 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=Lxx09580 PE=3 SV=2 287 495 4.0E-15
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 146 309 4.0E-15
sp|Q9J5I3|V018_FOWPN Putative ankyrin repeat protein FPV018 OS=Fowlpox virus (strain NVSL) GN=FPV018 PE=3 SV=1 67 340 4.0E-15
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 179 396 4.0E-15
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 171 488 5.0E-15
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 82 308 5.0E-15
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 52 264 5.0E-15
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 208 406 5.0E-15
sp|Q07E43|ASZ1_DASNO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 174 362 5.0E-15
sp|Q07DY6|ASZ1_COLGU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 189 362 5.0E-15
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 203 401 5.0E-15
sp|Q923M0|PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 182 441 5.0E-15
sp|Q2QLB5|ASZ1_CALMO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callicebus moloch GN=ASZ1 PE=3 SV=1 255 428 5.0E-15
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 242 424 5.0E-15
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 114 339 5.0E-15
sp|Q2QLG0|ASZ1_CALJA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 193 362 5.0E-15
sp|Q862Z2|ASB5_RABIT Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 147 340 5.0E-15
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 248 418 5.0E-15
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 116 339 5.0E-15
sp|Q91ZT8|ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 112 333 5.0E-15
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 179 396 5.0E-15
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 281 492 6.0E-15
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 272 483 6.0E-15
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 213 383 6.0E-15
sp|Q9J5H7|V024_FOWPN Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 31 380 6.0E-15
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 82 300 6.0E-15
sp|A1ZBY1|FEM1B_DROME Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 111 298 6.0E-15
sp|Q09YH1|ASZ1_SAIBB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 185 362 6.0E-15
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 248 430 6.0E-15
sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 184 478 6.0E-15
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 183 387 6.0E-15
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 103 352 7.0E-15
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 82 300 7.0E-15
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 242 424 7.0E-15
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 291 498 7.0E-15
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 179 396 7.0E-15
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 179 396 7.0E-15
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 248 418 7.0E-15
sp|Q8N9B4|ANR42_HUMAN Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 136 376 8.0E-15
sp|Q07DY6|ASZ1_COLGU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 152 329 8.0E-15
sp|Q2IBF5|ASZ1_GORGO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 189 362 8.0E-15
sp|Q8WMX6|ASZ1_PANTR Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 189 362 8.0E-15
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 178 443 8.0E-15
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 179 396 8.0E-15
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 251 424 8.0E-15
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 78 341 9.0E-15
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 103 262 9.0E-15
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 95 299 9.0E-15
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 95 299 9.0E-15
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 248 430 9.0E-15
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 304 499 1.0E-14
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 335 496 1.0E-14
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 287 483 1.0E-14
sp|Q8N9B4|ANR42_HUMAN Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 51 296 1.0E-14
sp|Q9H672|ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 103 321 1.0E-14
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 150 351 1.0E-14
sp|Q09YN0|ASZ1_RABIT Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 174 362 1.0E-14
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 213 445 1.0E-14
sp|Q8VHS5|ASB16_MOUSE Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 166 416 1.0E-14
sp|Q9J5I7|V014_FOWPN Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 152 401 1.0E-14
sp|Q2QLA4|ASZ1_HORSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 174 362 1.0E-14
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 299 483 1.0E-14
sp|Q8WWH4|ASZ1_HUMAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 189 362 1.0E-14
sp|Q91ZU0|ASB7_MOUSE Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 103 321 1.0E-14
sp|Q07DV3|ASZ1_AOTNA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 251 428 1.0E-14
sp|Q862Z2|ASB5_RABIT Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 168 402 1.0E-14
sp|Q5UPA2|YL023_MIMIV Putative ankyrin repeat protein L23 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L23 PE=3 SV=1 251 404 1.0E-14
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 116 339 1.0E-14
sp|Q6AFL2|Y958_LEIXX Putative ankyrin-containing lipoprotein Lxx09580 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=Lxx09580 PE=3 SV=2 254 402 1.0E-14
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 248 418 1.0E-14
sp|Q9J5G9|V034_FOWPN Putative ankyrin repeat protein FPV034 OS=Fowlpox virus (strain NVSL) GN=ANK2 PE=3 SV=1 145 393 1.0E-14
sp|Q499M5|ANR16_RAT Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 277 496 2.0E-14
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 147 535 2.0E-14
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 276 496 2.0E-14
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 213 383 2.0E-14
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 145 529 2.0E-14
sp|Q8N9B4|ANR42_HUMAN Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 233 499 2.0E-14
sp|Q9BGT9|ASB7_MACFA Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 103 321 2.0E-14
sp|A0M8T3|ASZ1_FELCA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 174 362 2.0E-14
sp|Q07E17|ASZ1_MUSPF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 174 362 2.0E-14
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 246 444 2.0E-14
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 246 444 2.0E-14
sp|Q07DX6|ASZ1_NOMLE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 189 362 2.0E-14
sp|Q2QLC6|ASZ1_CARPS Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 255 424 2.0E-14
sp|Q96I34|PP16A_HUMAN Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens GN=PPP1R16A PE=1 SV=1 182 439 2.0E-14
sp|Q9J5H5|V026_FOWPN Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 215 406 2.0E-14
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 248 465 2.0E-14
sp|Q6KAE5|XB32_ORYSJ Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 213 416 2.0E-14
sp|Q6DRG7|MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 152 386 2.0E-14
sp|Q8WWX0|ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 168 402 2.0E-14
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 248 413 2.0E-14
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 168 402 2.0E-14
sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 192 447 2.0E-14
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 248 418 2.0E-14
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 114 339 2.0E-14
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 152 296 2.0E-14
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 179 396 2.0E-14
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 114 339 2.0E-14
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 183 387 2.0E-14
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 291 498 2.0E-14
sp|Q3SZE4|ASB11_BOVIN Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 144 366 2.0E-14
sp|Q5UPG0|YL086_MIMIV Putative ankyrin repeat protein L86 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L86 PE=3 SV=1 94 475 2.0E-14
sp|Q8VHK1|CSKI2_MOUSE Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 212 401 2.0E-14
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 291 498 2.0E-14
sp|P14360|V240_FOWPN Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 114 345 2.0E-14
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 276 496 3.0E-14
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 145 296 3.0E-14
sp|Q5UPE3|YL062_MIMIV Putative ankyrin repeat protein L62 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L62 PE=3 SV=1 128 373 3.0E-14
sp|Q9TXQ1|TNKS1_CAEEL Tankyrase-like protein OS=Caenorhabditis elegans GN=tank-1 PE=2 SV=1 115 429 3.0E-14
sp|Q8VHS5|ASB16_MOUSE Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 112 317 3.0E-14
sp|Q2IBB4|ASZ1_RHIFE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 174 362 3.0E-14
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 178 362 3.0E-14
sp|Q91ZU0|ASB7_MOUSE Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 82 335 3.0E-14
sp|Q07DZ7|ASZ1_ORNAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 207 426 3.0E-14
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 266 573 3.0E-14
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 147 340 3.0E-14
sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 131 332 3.0E-14
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 215 529 4.0E-14
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 174 362 4.0E-14
sp|Q8WMX8|ASZ1_BOVIN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 174 362 4.0E-14
sp|Q09YI3|ASZ1_SHEEP Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 174 362 4.0E-14
sp|Q09YJ5|ASZ1_MUNMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 174 358 4.0E-14
sp|Q5UPA2|YL023_MIMIV Putative ankyrin repeat protein L23 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L23 PE=3 SV=1 130 306 4.0E-14
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 77 296 4.0E-14
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 243 428 4.0E-14
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 114 339 4.0E-14
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 114 339 4.0E-14
sp|Q9J5G9|V034_FOWPN Putative ankyrin repeat protein FPV034 OS=Fowlpox virus (strain NVSL) GN=ANK2 PE=3 SV=1 128 416 4.0E-14
sp|Q8WXI3|ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 115 334 4.0E-14
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 86 253 4.0E-14
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 83 335 5.0E-14
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 244 486 5.0E-14
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 82 308 5.0E-14
sp|Q5UP19|YR864_MIMIV Putative ankyrin repeat protein R864 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L864 PE=3 SV=1 251 465 5.0E-14
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 213 388 5.0E-14
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 233 442 5.0E-14
sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 101 364 5.0E-14
sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 132 349 5.0E-14
sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 243 473 5.0E-14
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 73 504 6.0E-14
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 86 341 6.0E-14
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 86 336 6.0E-14
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 290 463 6.0E-14
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 152 403 6.0E-14
sp|Q07E30|ASZ1_NEONE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 174 362 6.0E-14
sp|A4D7T3|ASZ1_MACEU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 235 421 6.0E-14
sp|Q2QLC6|ASZ1_CARPS Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 152 325 6.0E-14
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 83 352 6.0E-14
sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 140 386 6.0E-14
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 114 339 6.0E-14
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 198 419 6.0E-14
sp|Q9QW30|NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 101 364 6.0E-14
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 149 385 6.0E-14
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 291 504 6.0E-14
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 297 460 7.0E-14
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 51 296 7.0E-14
sp|Q09YK6|ASZ1_ATEGE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ateles geoffroyi GN=ASZ1 PE=3 SV=1 152 329 7.0E-14
sp|A1X154|ASZ1_ECHTE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 152 329 7.0E-14
sp|Q09YH1|ASZ1_SAIBB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 277 428 7.0E-14
sp|Q10728|MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 140 386 7.0E-14
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 154 415 7.0E-14
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 180 539 8.0E-14
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 116 316 8.0E-14
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 83 352 8.0E-14
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 213 383 8.0E-14
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 83 496 8.0E-14
sp|Q2QLG0|ASZ1_CALJA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 277 428 8.0E-14
sp|Q6KAE5|XB32_ORYSJ Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 67 265 8.0E-14
sp|Q4JHE0|XB36_ORYSJ Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 147 328 8.0E-14
sp|Q9D2X0|ANR39_MOUSE Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=1 SV=1 251 364 8.0E-14
sp|Q9BSK4|FEM1A_HUMAN Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 269 466 9.0E-14
sp|Q8WWX0|ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 233 442 9.0E-14
sp|Q7EZ44|XB35_ORYSJ Probable E3 ubiquitin-protein ligase XBOS35 OS=Oryza sativa subsp. japonica GN=XBOS35 PE=2 SV=1 213 416 9.0E-14
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 251 413 9.0E-14
sp|Q6UB99|ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 327 429 9.0E-14
sp|Q4FE45|XB33_ARATH E3 ubiquitin-protein ligase XBAT33 OS=Arabidopsis thaliana GN=XBAT33 PE=2 SV=1 213 416 9.0E-14
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 67 242 1.0E-13
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 116 316 1.0E-13
sp|A2AS55|ANR16_MOUSE Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 277 499 1.0E-13
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 53 369 1.0E-13
sp|Q5UP11|YR848_MIMIV Putative ankyrin repeat protein R848 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R848 PE=3 SV=1 248 465 1.0E-13
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 70 352 1.0E-13
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 292 504 1.0E-13
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 317 528 1.0E-13
sp|Q96AX9|MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 60 496 1.0E-13
sp|Q09YK6|ASZ1_ATEGE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ateles geoffroyi GN=ASZ1 PE=3 SV=1 277 428 1.0E-13
sp|Q2QL84|ASZ1_MICMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 174 362 1.0E-13
sp|Q2QLC6|ASZ1_CARPS Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 204 376 1.0E-13
sp|Q2QLC6|ASZ1_CARPS Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 174 358 1.0E-13
sp|O60237|MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens GN=PPP1R12B PE=1 SV=2 185 456 1.0E-13
sp|Q9J5H8|V023_FOWPN Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 215 431 1.0E-13
sp|Q862Z2|ASB5_RABIT Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 233 442 1.0E-13
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 174 397 1.0E-13
sp|Q3SZE4|ASB11_BOVIN Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 172 395 1.0E-13
sp|Q8VHK1|CSKI2_MOUSE Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 132 349 1.0E-13
sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 115 368 1.0E-13
sp|Q8BG95|MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus GN=Ppp1r12b PE=1 SV=2 185 452 1.0E-13
sp|Q0P5B9|ANR39_BOVIN Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 251 395 1.0E-13
sp|Q05753|AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 225 413 1.0E-13
sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 115 368 1.0E-13
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 99 369 1.0E-13
sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 101 364 1.0E-13
sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 175 317 1.0E-13
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 345 509 2.0E-13
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 309 458 2.0E-13
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 287 510 2.0E-13
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 275 498 2.0E-13
sp|Q9J516|V219_FOWPN Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 243 496 2.0E-13
sp|Q2QLH1|ASZ1_OTOGA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Otolemur garnettii GN=ASZ1 PE=3 SV=1 174 362 2.0E-13
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 145 329 2.0E-13
sp|Q2IBG0|ASZ1_EULMM Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 174 362 2.0E-13
sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 152 386 2.0E-13
sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 140 386 2.0E-13
sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 109 417 2.0E-13
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 209 438 2.0E-13
sp|Q9Y574|ASB4_HUMAN Ankyrin repeat and SOCS box protein 4 OS=Homo sapiens GN=ASB4 PE=2 SV=1 109 334 2.0E-13
sp|Q8WXH4|ASB11_HUMAN Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 144 366 2.0E-13
sp|Q9Y566|SHAN1_HUMAN SH3 and multiple ankyrin repeat domains protein 1 OS=Homo sapiens GN=SHANK1 PE=1 SV=2 255 460 2.0E-13
sp|Q5RFS1|ASB11_PONAB Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 144 364 2.0E-13
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 345 509 3.0E-13
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 189 513 3.0E-13
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 281 492 3.0E-13
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 152 496 3.0E-13
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 83 296 3.0E-13
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 82 265 3.0E-13
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 103 257 3.0E-13
sp|Q07DZ7|ASZ1_ORNAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 182 362 3.0E-13
sp|Q862Z2|ASB5_RABIT Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 211 416 3.0E-13
sp|Q8WWX0|ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 211 416 3.0E-13
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 180 402 3.0E-13
sp|Q96NS5|ASB16_HUMAN Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens GN=ASB16 PE=1 SV=2 112 317 3.0E-13
sp|Q9CQ31|ASB11_MOUSE Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 144 366 3.0E-13
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 243 420 3.0E-13
sp|Q9J507|V228_FOWPN Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 95 282 4.0E-13
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 213 463 4.0E-13
sp|Q9J5H5|V026_FOWPN Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 144 335 4.0E-13
sp|P14368|V234_FOWPN Putative ankyrin repeat protein FPV234 OS=Fowlpox virus (strain NVSL) GN=FPV234 PE=3 SV=2 184 469 4.0E-13
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 255 529 5.0E-13
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 106 270 5.0E-13
sp|Q95N27|PP16B_BOVIN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 92 287 5.0E-13
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 185 397 5.0E-13
sp|Q54LF0|SIR2B_DICDI NAD-dependent deacetylase sir2B OS=Dictyostelium discoideum GN=sir2B PE=2 SV=1 109 429 5.0E-13
sp|Q5UPB9|YL042_MIMIV Putative ankyrin repeat protein L42 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L42 PE=3 SV=1 248 496 5.0E-13
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 243 420 5.0E-13
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 317 535 6.0E-13
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 144 329 6.0E-13
sp|Q91ZT8|ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 177 376 6.0E-13
sp|Q9BXX2|AN30B_HUMAN Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 184 411 6.0E-13
sp|Q1RI12|Y921_RICBR Putative ankyrin repeat protein RBE_0921 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0921 PE=3 SV=1 145 480 6.0E-13
sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 91 300 6.0E-13
sp|Q58CT0|DYH12_BOVIN Dynein heavy chain 12, axonemal OS=Bos taurus GN=DNAH12 PE=2 SV=1 194 401 6.0E-13
sp|O60733|PLPL9_HUMAN 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 144 387 6.0E-13
sp|Q9Z2F6|BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 243 473 6.0E-13
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 83 263 7.0E-13
sp|P77736|YAHD_ECOLI Putative ankyrin repeat protein YahD OS=Escherichia coli (strain K12) GN=yahD PE=3 SV=1 250 400 7.0E-13
sp|Q7XUW4|KOR2_ORYSJ Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 251 413 7.0E-13
sp|Q96T49|PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 92 287 8.0E-13
sp|Q99466|NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 178 446 8.0E-13
sp|Q96HA7|TONSL_HUMAN Tonsoku-like protein OS=Homo sapiens GN=TONSL PE=1 SV=2 106 217 8.0E-13
sp|Q5UPB4|YL036_MIMIV Putative ankyrin repeat protein L36 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L36 PE=3 SV=1 160 370 8.0E-13
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 342 540 9.0E-13
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 287 467 9.0E-13
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 83 263 9.0E-13
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 114 306 9.0E-13
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 147 333 9.0E-13
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 180 346 9.0E-13
sp|Q7XUW4|KOR2_ORYSJ Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 128 340 9.0E-13
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 25 280 1.0E-12
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 250 535 1.0E-12
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 342 501 1.0E-12
sp|Q8N9B4|ANR42_HUMAN Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 329 497 1.0E-12
sp|Q9J516|V219_FOWPN Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 144 422 1.0E-12
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 49 247 1.0E-12
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 49 247 1.0E-12
sp|A1ZBY1|FEM1B_DROME Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 202 391 1.0E-12
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 120 323 1.0E-12
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 180 402 1.0E-12
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 218 405 1.0E-12
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 128 338 1.0E-12
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 128 338 1.0E-12
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 218 406 1.0E-12
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 233 442 1.0E-12
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 278 428 1.0E-12
sp|Q8WXI3|ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 180 434 1.0E-12
sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 109 417 1.0E-12
sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 114 451 1.0E-12
sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 224 421 1.0E-12
sp|Q9D738|ASB12_MOUSE Ankyrin repeat and SOCS box protein 12 OS=Mus musculus GN=Asb12 PE=2 SV=1 145 303 1.0E-12
sp|Q9WV48|SHAN1_RAT SH3 and multiple ankyrin repeat domains protein 1 OS=Rattus norvegicus GN=Shank1 PE=1 SV=1 128 332 1.0E-12
sp|Q9WV48|SHAN1_RAT SH3 and multiple ankyrin repeat domains protein 1 OS=Rattus norvegicus GN=Shank1 PE=1 SV=1 255 460 1.0E-12
sp|D3YZU1|SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus GN=Shank1 PE=1 SV=1 128 332 1.0E-12
sp|D3YZU1|SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus GN=Shank1 PE=1 SV=1 255 460 1.0E-12
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 102 250 1.0E-12
sp|Q94CT7|XB31_ORYSJ Probable E3 ubiquitin-protein ligase XBOS31 OS=Oryza sativa subsp. japonica GN=XBOS31 PE=2 SV=1 143 362 1.0E-12
sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 105 269 1.0E-12
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 345 509 2.0E-12
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 50 263 2.0E-12
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 90 285 2.0E-12
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 342 501 2.0E-12
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 269 496 2.0E-12
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 317 492 2.0E-12
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 145 512 2.0E-12
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 115 366 2.0E-12
sp|Q9TXQ1|TNKS1_CAEEL Tankyrase-like protein OS=Caenorhabditis elegans GN=tank-1 PE=2 SV=1 144 488 2.0E-12
sp|Q07E17|ASZ1_MUSPF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 287 467 2.0E-12
sp|Q07E30|ASZ1_NEONE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 287 467 2.0E-12
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 120 321 2.0E-12
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 213 421 2.0E-12
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 180 402 2.0E-12
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 180 402 2.0E-12
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 180 402 2.0E-12
sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 145 331 2.0E-12
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 278 498 2.0E-12
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 278 498 2.0E-12
sp|P14360|V240_FOWPN Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 212 401 2.0E-12
sp|Q7EZ44|XB35_ORYSJ Probable E3 ubiquitin-protein ligase XBOS35 OS=Oryza sativa subsp. japonica GN=XBOS35 PE=2 SV=1 117 317 2.0E-12
sp|Q8WXH4|ASB11_HUMAN Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 180 395 2.0E-12
sp|Q5RFS1|ASB11_PONAB Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 180 395 2.0E-12
sp|Q1RI12|Y921_RICBR Putative ankyrin repeat protein RBE_0921 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0921 PE=3 SV=1 170 499 2.0E-12
sp|Q9D738|ASB12_MOUSE Ankyrin repeat and SOCS box protein 12 OS=Mus musculus GN=Asb12 PE=2 SV=1 213 402 2.0E-12
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 147 296 2.0E-12
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 209 332 2.0E-12
sp|Q6C520|AKR1_YARLI Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 209 420 2.0E-12
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 120 307 2.0E-12
sp|Q1RJR6|Y317_RICBR Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 368 510 2.0E-12
sp|D4A615|TONSL_RAT Tonsoku-like protein OS=Rattus norvegicus GN=Tonsl PE=3 SV=1 123 217 2.0E-12
sp|O14593|RFXK_HUMAN DNA-binding protein RFXANK OS=Homo sapiens GN=RFXANK PE=1 SV=2 171 296 2.0E-12
sp|Q4I8B6|AKR1_GIBZE Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 243 412 2.0E-12
sp|Q5XJ13|ANKS6_DANRE Ankyrin repeat and SAM domain-containing protein 6 OS=Danio rerio GN=anks6 PE=2 SV=1 103 316 2.0E-12
sp|Q8WXK4|ASB12_HUMAN Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 145 303 2.0E-12
sp|Q9Z205|RFXK_MOUSE DNA-binding protein RFXANK OS=Mus musculus GN=Rfxank PE=2 SV=1 165 298 2.0E-12
sp|Q6NZL6|TONSL_MOUSE Tonsoku-like protein OS=Mus musculus GN=Tonsl PE=1 SV=2 123 217 2.0E-12
sp|Q5UQJ0|YR835_MIMIV Putative ankyrin repeat protein R835 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R835 PE=3 SV=1 82 231 2.0E-12
sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 329 491 2.0E-12
sp|Q10311|YD58_SCHPO Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 141 316 2.0E-12
sp|Q5UPP7|YR760_MIMIV Putative ankyrin repeat protein R760 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R760 PE=3 SV=1 42 555 2.0E-12
sp|O90760|V031_FOWPN Putative ankyrin repeat protein FPV031 OS=Fowlpox virus (strain NVSL) GN=ANK3 PE=3 SV=1 117 264 2.0E-12
sp|Q5UQJ2|YR863_MIMIV Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 253 497 3.0E-12
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 98 335 3.0E-12
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 78 341 3.0E-12
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 305 496 3.0E-12
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 50 370 3.0E-12
sp|Q8VD46|ASZ1_MOUSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 228 467 3.0E-12
sp|Q2IBB4|ASZ1_RHIFE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 63 263 3.0E-12
sp|Q9J5I7|V014_FOWPN Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 77 359 3.0E-12
sp|Q108U1|ASZ1_LOXAF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 287 445 3.0E-12
sp|Q8VHQ3|PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=1 SV=1 92 287 3.0E-12
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 38 308 3.0E-12
sp|Q4JHE0|XB36_ORYSJ Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 246 416 3.0E-12
sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 140 359 3.0E-12
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 247 496 3.0E-12
sp|Q9Y566|SHAN1_HUMAN SH3 and multiple ankyrin repeat domains protein 1 OS=Homo sapiens GN=SHANK1 PE=1 SV=2 128 332 3.0E-12
sp|Q9Z2F6|BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 140 359 3.0E-12
sp|Q5UPR3|YR777_MIMIV Putative ankyrin repeat protein R777 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R777 PE=3 SV=1 83 312 3.0E-12
sp|Q8TF21|ANR24_HUMAN Ankyrin repeat domain-containing protein 24 OS=Homo sapiens GN=ANKRD24 PE=2 SV=2 243 428 3.0E-12
sp|Q5UR87|YR634_MIMIV Putative ankyrin repeat protein R634 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R634 PE=3 SV=1 46 304 4.0E-12
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 281 492 4.0E-12
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 343 496 4.0E-12
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 343 496 4.0E-12
sp|Q5UPU4|YR267_MIMIV Putative ankyrin repeat protein R267 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R267 PE=3 SV=1 256 552 4.0E-12
sp|Q96I34|PP16A_HUMAN Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens GN=PPP1R16A PE=1 SV=1 91 254 4.0E-12
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 108 298 4.0E-12
sp|Q862Z2|ASB5_RABIT Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 99 308 4.0E-12
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 278 502 4.0E-12
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 265 429 4.0E-12
sp|Q4FE45|XB33_ARATH E3 ubiquitin-protein ligase XBAT33 OS=Arabidopsis thaliana GN=XBAT33 PE=2 SV=1 117 362 4.0E-12
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 183 369 4.0E-12
sp|Q5UQV3|YL371_MIMIV Putative ankyrin repeat protein L371 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L371 PE=3 SV=1 78 453 4.0E-12
sp|Q0P5G1|TONSL_BOVIN Tonsoku-like protein OS=Bos taurus GN=TONSL PE=2 SV=1 123 253 4.0E-12
sp|Q5EA33|ANR49_BOVIN Ankyrin repeat domain-containing protein 49 OS=Bos taurus GN=ANKRD49 PE=2 SV=1 160 277 4.0E-12
sp|Q5UPD5|YL059_MIMIV Putative ankyrin repeat protein L59 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L59 PE=3 SV=1 68 297 4.0E-12
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 209 332 4.0E-12
sp|Q5UPB6|YL045_MIMIV Putative ankyrin repeat protein L45 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L45 PE=3 SV=1 247 396 4.0E-12
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 51 321 5.0E-12
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 342 540 5.0E-12
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 342 501 5.0E-12
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 342 501 5.0E-12
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 342 501 5.0E-12
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 342 501 5.0E-12
sp|Q2IBG0|ASZ1_EULMM Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 225 431 5.0E-12
sp|A1ZBY1|FEM1B_DROME Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 147 365 5.0E-12
sp|Q5UPA2|YL023_MIMIV Putative ankyrin repeat protein L23 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L23 PE=3 SV=1 162 339 5.0E-12
sp|Q91ZT8|ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 146 343 5.0E-12
sp|Q0P5B9|ANR39_BOVIN Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 323 464 5.0E-12
sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 141 296 5.0E-12
sp|Q5RFS1|ASB11_PONAB Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 99 307 5.0E-12
sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 131 332 5.0E-12
sp|Q4P6L3|AKR1_USTMA Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 167 416 5.0E-12
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 189 416 5.0E-12
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 189 416 5.0E-12
sp|Q52T38|ZDH22_ARATH Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 294 491 5.0E-12
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 306 496 6.0E-12
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 287 485 6.0E-12
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 305 506 6.0E-12
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 343 496 6.0E-12
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 279 463 6.0E-12
sp|Q337A0|XB33_ORYSJ Probable E3 ubiquitin-protein ligase XBOS33 OS=Oryza sativa subsp. japonica GN=XBOS33 PE=2 SV=1 117 362 6.0E-12
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 185 367 6.0E-12
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 185 367 6.0E-12
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 98 351 6.0E-12
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 202 362 6.0E-12
sp|Q5UQZ5|YR903_MIMIV Putative ankyrin repeat protein R903 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R903 PE=3 SV=1 98 402 6.0E-12
sp|Q9J5I9|V012_FOWPN Putative ankyrin repeat protein FPV012 OS=Fowlpox virus (strain NVSL) GN=FPV012 PE=3 SV=1 114 235 6.0E-12
sp|Q99PE2|ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 202 355 6.0E-12
sp|A9JR78|TONSL_DANRE Tonsoku-like protein OS=Danio rerio GN=tonsl PE=2 SV=1 140 248 6.0E-12
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 243 420 6.0E-12
sp|Q641X1|ANR61_RAT Ankyrin repeat domain-containing protein 61 OS=Rattus norvegicus GN=Ankrd61 PE=2 SV=1 229 428 6.0E-12
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 139 264 6.0E-12
sp|Q9WV06|ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 251 412 6.0E-12
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 358 501 7.0E-12
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 132 343 7.0E-12
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 279 464 7.0E-12
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 211 420 7.0E-12
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 196 395 7.0E-12
sp|Q96NS5|ASB16_HUMAN Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens GN=ASB16 PE=1 SV=2 247 447 7.0E-12
sp|B0G124|Y9043_DICDI Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 128 260 7.0E-12
sp|Q5UQI8|YR837_MIMIV Putative ankyrin repeat protein R837 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R837 PE=3 SV=1 108 529 7.0E-12
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 90 285 8.0E-12
sp|Q5UPE3|YL062_MIMIV Putative ankyrin repeat protein L62 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L62 PE=3 SV=1 193 469 8.0E-12
sp|Q9J516|V219_FOWPN Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 103 353 8.0E-12
sp|A1X154|ASZ1_ECHTE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 284 445 8.0E-12
sp|Q5UP19|YR864_MIMIV Putative ankyrin repeat protein R864 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L864 PE=3 SV=1 90 305 8.0E-12
sp|Q9BZL4|PP12C_HUMAN Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens GN=PPP1R12C PE=1 SV=1 144 317 8.0E-12
sp|Q3UMT1|PP12C_MOUSE Protein phosphatase 1 regulatory subunit 12C OS=Mus musculus GN=Ppp1r12c PE=1 SV=1 144 317 8.0E-12
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 149 374 8.0E-12
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 196 395 8.0E-12
sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 248 480 8.0E-12
sp|Q8WXH4|ASB11_HUMAN Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 99 307 8.0E-12
sp|O14593|RFXK_HUMAN DNA-binding protein RFXANK OS=Homo sapiens GN=RFXANK PE=1 SV=2 186 332 8.0E-12
sp|Q9J503|V232_FOWPN Putative ankyrin repeat protein FPV232 OS=Fowlpox virus (strain NVSL) GN=FPV232 PE=3 SV=1 181 430 8.0E-12
sp|Q9J4Z8|V242_FOWPN Putative ankyrin repeat protein FPV242 OS=Fowlpox virus (strain NVSL) GN=FPV242 PE=3 SV=1 108 371 8.0E-12
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 251 416 8.0E-12
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 342 501 9.0E-12
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 278 509 9.0E-12
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 105 296 9.0E-12
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 202 362 9.0E-12
sp|Q6ZVZ8|ASB18_HUMAN Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens GN=ASB18 PE=2 SV=2 180 413 9.0E-12
sp|Q8N2N9|AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 185 385 9.0E-12
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 26 242 1.0E-11
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 99 233 1.0E-11
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 86 233 1.0E-11
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 342 506 1.0E-11
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 342 501 1.0E-11
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 254 496 1.0E-11
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 276 487 1.0E-11
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 236 496 1.0E-11
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 82 265 1.0E-11
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 106 304 1.0E-11
sp|Q2QLC6|ASZ1_CARPS Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 287 431 1.0E-11
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 185 397 1.0E-11
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 215 428 1.0E-11
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 169 385 1.0E-11
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 98 351 1.0E-11
sp|Q3SZE4|ASB11_BOVIN Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 99 296 1.0E-11
sp|Q3SZE4|ASB11_BOVIN Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 243 519 1.0E-11
sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 243 471 1.0E-11
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 248 395 1.0E-11
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 196 411 1.0E-11
sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 114 445 1.0E-11
sp|Q9Y566|SHAN1_HUMAN SH3 and multiple ankyrin repeat domains protein 1 OS=Homo sapiens GN=SHANK1 PE=1 SV=2 221 428 1.0E-11
sp|O60733|PLPL9_HUMAN 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 206 456 1.0E-11
sp|Q99PE2|ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 209 332 1.0E-11
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 105 296 1.0E-11
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 117 263 1.0E-11
sp|Q5UQY4|YR886_MIMIV Putative ankyrin repeat protein R886 (Fragment) OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R886 PE=4 SV=1 229 341 1.0E-11
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 292 447 1.0E-11
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 189 334 1.0E-11
sp|Q876L5|AKR1_SACU7 Palmitoyltransferase AKR1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AKR1 PE=3 SV=2 213 420 1.0E-11
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 251 412 1.0E-11
sp|Q8IUH5|ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 117 318 1.0E-11
sp|Q755Y0|AKR1_ASHGO Palmitoyltransferase AKR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AKR1 PE=3 SV=1 99 261 1.0E-11
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 243 395 1.0E-11
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 182 513 2.0E-11
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 276 492 2.0E-11
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 342 501 2.0E-11
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 342 501 2.0E-11
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 342 506 2.0E-11
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 342 496 2.0E-11
sp|Q07DY6|ASZ1_COLGU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 288 431 2.0E-11
sp|Q07DX6|ASZ1_NOMLE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 288 431 2.0E-11
sp|Q2IBE3|ASZ1_PONAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 288 431 2.0E-11
sp|Q6ZVH7|ESPNL_HUMAN Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 98 329 2.0E-11
sp|Q337A0|XB33_ORYSJ Probable E3 ubiquitin-protein ligase XBOS33 OS=Oryza sativa subsp. japonica GN=XBOS33 PE=2 SV=1 115 369 2.0E-11
sp|Q337A0|XB33_ORYSJ Probable E3 ubiquitin-protein ligase XBOS33 OS=Oryza sativa subsp. japonica GN=XBOS33 PE=2 SV=1 83 256 2.0E-11
sp|Q9J5H8|V023_FOWPN Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 125 315 2.0E-11
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 196 383 2.0E-11
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 108 298 2.0E-11
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 278 498 2.0E-11
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 169 362 2.0E-11
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 120 263 2.0E-11
sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 228 419 2.0E-11
sp|Q6UB99|ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 336 433 2.0E-11
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 147 316 2.0E-11
sp|Q5UPB9|YL042_MIMIV Putative ankyrin repeat protein L42 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L42 PE=3 SV=1 112 366 2.0E-11
sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 204 302 2.0E-11
sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 298 416 2.0E-11
sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 244 343 2.0E-11
sp|Q8WXK4|ASB12_HUMAN Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 175 309 2.0E-11
sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 228 421 2.0E-11
sp|Q9J5I9|V012_FOWPN Putative ankyrin repeat protein FPV012 OS=Fowlpox virus (strain NVSL) GN=FPV012 PE=3 SV=1 175 316 2.0E-11
sp|Q755Y0|AKR1_ASHGO Palmitoyltransferase AKR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AKR1 PE=3 SV=1 251 420 2.0E-11
sp|Q5UQF2|YL482_MIMIV Putative ankyrin repeat protein L482 (Fragment) OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L482 PE=4 SV=1 248 363 2.0E-11
sp|Q5UPG6|YL092_MIMIV Putative ankyrin repeat protein L92 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L92 PE=3 SV=1 152 414 2.0E-11
sp|Q9WV71|ASB4_MOUSE Ankyrin repeat and SOCS box protein 4 OS=Mus musculus GN=Asb4 PE=1 SV=1 189 380 2.0E-11
sp|Q5UPI6|YL112_MIMIV Putative ankyrin repeat protein L112 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L112 PE=4 SV=1 111 425 2.0E-11
sp|Q8TAK5|GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 120 307 2.0E-11
sp|Q8VE42|ANR49_MOUSE Ankyrin repeat domain-containing protein 49 OS=Mus musculus GN=Ankrd49 PE=1 SV=1 160 252 2.0E-11
sp|Q8T2Q0|ZDHC6_DICDI Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 244 428 2.0E-11
sp|Q8WVL7|ANR49_HUMAN Ankyrin repeat domain-containing protein 49 OS=Homo sapiens GN=ANKRD49 PE=1 SV=1 160 252 2.0E-11
sp|Q86U10|LPP60_HUMAN 60 kDa lysophospholipase OS=Homo sapiens GN=ASPG PE=2 SV=3 152 298 2.0E-11
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 163 498 3.0E-11
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 50 270 3.0E-11
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 333 487 3.0E-11
sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 132 317 3.0E-11
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 149 374 3.0E-11
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 196 395 3.0E-11
sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 365 499 3.0E-11
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 196 395 3.0E-11
sp|Q8N2N9|AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 156 364 3.0E-11
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 144 316 3.0E-11
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 80 296 3.0E-11
sp|Q5UQ04|YR791_MIMIV Putative ankyrin repeat protein R791 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R791 PE=3 SV=1 83 305 3.0E-11
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 50 242 4.0E-11
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 279 496 4.0E-11
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 83 236 4.0E-11
sp|Q2QLC6|ASZ1_CARPS Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 63 258 4.0E-11
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 211 428 4.0E-11
sp|Q53RE8|ANR39_HUMAN Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 323 446 4.0E-11
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 79 319 4.0E-11
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 246 365 4.0E-11
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 281 428 4.0E-11
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 117 276 4.0E-11
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 159 301 4.0E-11
sp|Q9WV71|ASB4_MOUSE Ankyrin repeat and SOCS box protein 4 OS=Mus musculus GN=Asb4 PE=1 SV=1 109 334 4.0E-11
sp|Q5UP15|YR844_MIMIV Putative ankyrin repeat protein R844 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R844 PE=3 SV=1 229 373 4.0E-11
sp|Q80TN5|ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 117 318 4.0E-11
sp|E9PTT0|ZDH17_RAT Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 103 318 4.0E-11
sp|Q02979|GDE1_YEAST Glycerophosphodiester phosphodiesterase GDE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDE1 PE=1 SV=1 65 200 4.0E-11
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 345 509 5.0E-11
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 323 538 5.0E-11
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 242 492 5.0E-11
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 347 498 5.0E-11
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 342 501 5.0E-11
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 333 487 5.0E-11
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 311 496 5.0E-11
sp|Q6KAE5|XB32_ORYSJ Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 111 317 5.0E-11
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 79 273 5.0E-11
sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 144 401 5.0E-11
sp|Q9WV48|SHAN1_RAT SH3 and multiple ankyrin repeat domains protein 1 OS=Rattus norvegicus GN=Shank1 PE=1 SV=1 221 428 5.0E-11
sp|Q9Z205|RFXK_MOUSE DNA-binding protein RFXANK OS=Mus musculus GN=Rfxank PE=2 SV=1 204 332 5.0E-11
sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 218 395 5.0E-11
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 202 401 5.0E-11
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 109 303 5.0E-11
sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 357 456 5.0E-11
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 120 451 5.0E-11
sp|Q8N7Z5|ANR31_HUMAN Putative ankyrin repeat domain-containing protein 31 OS=Homo sapiens GN=ANKRD31 PE=5 SV=2 340 450 5.0E-11
sp|Q91974|IKBA_CHICK NF-kappa-B inhibitor alpha OS=Gallus gallus GN=NFKBIA PE=2 SV=1 246 378 5.0E-11
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 13 231 6.0E-11
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 342 501 6.0E-11
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 342 501 6.0E-11
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 342 501 6.0E-11
sp|Q2IBB4|ASZ1_RHIFE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 287 467 6.0E-11
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 176 536 6.0E-11
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 176 536 6.0E-11
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 211 428 6.0E-11
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 196 383 6.0E-11
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 196 383 6.0E-11
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 196 395 6.0E-11
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 149 354 6.0E-11
sp|Q9D2X0|ANR39_MOUSE Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=1 SV=1 323 446 6.0E-11
sp|Q0P5B9|ANR39_BOVIN Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 152 265 6.0E-11
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 117 414 6.0E-11
sp|D3YZU1|SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus GN=Shank1 PE=1 SV=1 221 428 6.0E-11
sp|Q9J5I9|V012_FOWPN Putative ankyrin repeat protein FPV012 OS=Fowlpox virus (strain NVSL) GN=FPV012 PE=3 SV=1 243 368 6.0E-11
sp|Q9TU71|ANKR1_RABIT Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 292 447 6.0E-11
sp|Q5UPV1|YL271_MIMIV Putative ankyrin repeat protein L271 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L271 PE=3 SV=1 144 395 6.0E-11
sp|P39010|AKR1_YEAST Palmitoyltransferase AKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKR1 PE=1 SV=1 202 420 6.0E-11
sp|Q865U8|ANKR1_PIG Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 292 447 6.0E-11
sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 357 456 6.0E-11
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 281 499 7.0E-11
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 342 501 7.0E-11
sp|A4D7T3|ASZ1_MACEU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 315 488 7.0E-11
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 196 395 7.0E-11
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 180 385 7.0E-11
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 196 383 7.0E-11
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 79 319 7.0E-11
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 312 487 7.0E-11
sp|Q6UB99|ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 99 201 7.0E-11
sp|Q6UB99|ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 204 333 7.0E-11
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 149 336 7.0E-11
sp|Q9WV71|ASB4_MOUSE Ankyrin repeat and SOCS box protein 4 OS=Mus musculus GN=Asb4 PE=1 SV=1 213 401 7.0E-11
sp|Q04861|NFKB1_CHICK Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus GN=NFKB1 PE=2 SV=2 246 413 7.0E-11
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 333 496 8.0E-11
sp|Q8VD46|ASZ1_MOUSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 267 488 8.0E-11
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 230 429 8.0E-11
sp|Q9Y6X6|MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 81 293 8.0E-11
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 348 534 8.0E-11
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 99 308 8.0E-11
sp|Q755Y0|AKR1_ASHGO Palmitoyltransferase AKR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AKR1 PE=3 SV=1 185 352 8.0E-11
sp|Q6NXT1|ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 357 456 8.0E-11
sp|Q9Z1P7|KANK3_MOUSE KN motif and ankyrin repeat domain-containing protein 3 OS=Mus musculus GN=Kank3 PE=1 SV=1 270 428 8.0E-11
sp|Q9CWU2|ZDH13_MOUSE Palmitoyltransferase ZDHHC13 OS=Mus musculus GN=Zdhhc13 PE=1 SV=2 120 329 8.0E-11
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 342 506 9.0E-11
sp|Q09YN0|ASZ1_RABIT Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 287 445 9.0E-11
sp|Q2QLB5|ASZ1_CALMO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callicebus moloch GN=ASZ1 PE=3 SV=1 287 431 9.0E-11
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 108 298 9.0E-11
sp|Q8VHK1|CSKI2_MOUSE Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 301 480 9.0E-11
sp|Q9CQ31|ASB11_MOUSE Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 180 395 9.0E-11
sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 171 284 9.0E-11
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 86 251 9.0E-11
sp|Q94B55|XB31_ARATH Putative E3 ubiquitin-protein ligase XBAT31 OS=Arabidopsis thaliana GN=XBAT31 PE=2 SV=1 215 421 9.0E-11
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 211 401 9.0E-11
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 34 233 1.0E-10
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 53 280 1.0E-10
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 53 220 1.0E-10
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 333 496 1.0E-10
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 342 506 1.0E-10
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 342 501 1.0E-10
sp|A0M8T3|ASZ1_FELCA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 323 488 1.0E-10
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 342 501 1.0E-10
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 323 488 1.0E-10
sp|A4D7T3|ASZ1_MACEU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 287 446 1.0E-10
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 132 343 1.0E-10
sp|Q2IBF5|ASZ1_GORGO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 288 431 1.0E-10
sp|Q2IBB1|ASZ1_CHLAE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 288 431 1.0E-10
sp|Q8WMX6|ASZ1_PANTR Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 288 431 1.0E-10
sp|Q8WMX7|ASZ1_PAPAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 288 431 1.0E-10
sp|Q8WWX0|ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 99 295 1.0E-10
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 211 428 1.0E-10
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 211 428 1.0E-10
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 211 428 1.0E-10
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 196 395 1.0E-10
sp|Q9J5G9|V034_FOWPN Putative ankyrin repeat protein FPV034 OS=Fowlpox virus (strain NVSL) GN=ANK2 PE=3 SV=1 160 473 1.0E-10
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 169 362 1.0E-10
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 169 362 1.0E-10
sp|Q8WXI3|ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 246 461 1.0E-10
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 168 363 1.0E-10
sp|Q9Y566|SHAN1_HUMAN SH3 and multiple ankyrin repeat domains protein 1 OS=Homo sapiens GN=SHANK1 PE=1 SV=2 75 296 1.0E-10
sp|Q5XJ13|ANKS6_DANRE Ankyrin repeat and SAM domain-containing protein 6 OS=Danio rerio GN=anks6 PE=2 SV=1 178 411 1.0E-10
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 251 413 1.0E-10
sp|Q8VE42|ANR49_MOUSE Ankyrin repeat domain-containing protein 49 OS=Mus musculus GN=Ankrd49 PE=1 SV=1 82 198 1.0E-10
sp|Q8N7Z5|ANR31_HUMAN Putative ankyrin repeat domain-containing protein 31 OS=Homo sapiens GN=ANKRD31 PE=5 SV=2 244 375 1.0E-10
sp|Q91974|IKBA_CHICK NF-kappa-B inhibitor alpha OS=Gallus gallus GN=NFKBIA PE=2 SV=1 158 329 1.0E-10
sp|P25963|IKBA_HUMAN NF-kappa-B inhibitor alpha OS=Homo sapiens GN=NFKBIA PE=1 SV=1 158 329 1.0E-10
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 140 248 1.0E-10
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 279 425 1.0E-10
sp|Q65XV2|XB3_ORYSJ E3 ubiquitin-protein ligase XB3 OS=Oryza sativa subsp. japonica GN=XB3 PE=1 SV=1 143 329 1.0E-10
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 132 282 1.0E-10
sp|Q5UQF1|YL483_MIMIV Putative ankyrin repeat protein L483 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L483 PE=3 SV=1 281 496 2.0E-10
sp|Q5UPH0|YL100_MIMIV Putative ankyrin repeat protein L100 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L100 PE=3 SV=1 248 494 2.0E-10
sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 50 263 2.0E-10
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 333 496 2.0E-10
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 50 263 2.0E-10
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 342 496 2.0E-10
sp|Q2IBB4|ASZ1_RHIFE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 323 488 2.0E-10
sp|Q8WMX8|ASZ1_BOVIN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 322 488 2.0E-10
sp|Q09YI3|ASZ1_SHEEP Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 315 488 2.0E-10
sp|Q2QLA4|ASZ1_HORSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 313 488 2.0E-10
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 145 498 2.0E-10
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 103 265 2.0E-10
sp|Q6KAE5|XB32_ORYSJ Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 248 505 2.0E-10
sp|Q6DRG7|MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 255 498 2.0E-10
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 196 383 2.0E-10
sp|Q6AFL2|Y958_LEIXX Putative ankyrin-containing lipoprotein Lxx09580 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=Lxx09580 PE=3 SV=2 155 334 2.0E-10
sp|Q6AFL2|Y958_LEIXX Putative ankyrin-containing lipoprotein Lxx09580 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=Lxx09580 PE=3 SV=2 244 400 2.0E-10
sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 336 499 2.0E-10
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 182 352 2.0E-10
sp|Q58CT0|DYH12_BOVIN Dynein heavy chain 12, axonemal OS=Bos taurus GN=DNAH12 PE=2 SV=1 327 506 2.0E-10
sp|Q5UQJ0|YR835_MIMIV Putative ankyrin repeat protein R835 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R835 PE=3 SV=1 189 363 2.0E-10
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 149 329 2.0E-10
sp|Q876L5|AKR1_SACU7 Palmitoyltransferase AKR1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AKR1 PE=3 SV=2 180 352 2.0E-10
sp|Q755Y0|AKR1_ASHGO Palmitoyltransferase AKR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AKR1 PE=3 SV=1 345 496 2.0E-10
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 197 365 2.0E-10
sp|Q8VE42|ANR49_MOUSE Ankyrin repeat domain-containing protein 49 OS=Mus musculus GN=Ankrd49 PE=1 SV=1 248 363 2.0E-10
sp|Q5UP15|YR844_MIMIV Putative ankyrin repeat protein R844 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R844 PE=3 SV=1 218 353 2.0E-10
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 140 248 2.0E-10
sp|Q5JPF3|AN36C_HUMAN Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 190 385 2.0E-10
sp|Q00653|NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens GN=NFKB2 PE=1 SV=4 196 413 2.0E-10
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 132 282 2.0E-10
sp|Q62415|ASPP1_MOUSE Apoptosis-stimulating of p53 protein 1 OS=Mus musculus GN=Ppp1r13b PE=1 SV=2 116 254 2.0E-10
sp|Q876A6|AKR1_NAUCC Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 120 318 2.0E-10
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 171 347 2.0E-10
sp|Q99549|MPP8_HUMAN M-phase phosphoprotein 8 OS=Homo sapiens GN=MPHOSPH8 PE=1 SV=2 281 428 2.0E-10
sp|P31695|NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 230 428 2.0E-10
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 205 510 3.0E-10
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 333 496 3.0E-10
sp|Q108U1|ASZ1_LOXAF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 267 491 3.0E-10
sp|Q09YJ5|ASZ1_MUNMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 322 488 3.0E-10
sp|Q3UMT1|PP12C_MOUSE Protein phosphatase 1 regulatory subunit 12C OS=Mus musculus GN=Ppp1r12c PE=1 SV=1 178 395 3.0E-10
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 235 522 3.0E-10
sp|Q6DRG7|MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 128 297 3.0E-10
sp|Q5UPA2|YL023_MIMIV Putative ankyrin repeat protein L23 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L23 PE=3 SV=1 46 206 3.0E-10
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 255 464 3.0E-10
sp|Q5UPD9|YL066_MIMIV Putative ankyrin repeat protein L66 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L66 PE=3 SV=1 38 401 3.0E-10
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 255 464 3.0E-10
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 255 464 3.0E-10
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 242 495 3.0E-10
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 79 265 3.0E-10
sp|Q3SZE4|ASB11_BOVIN Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 101 274 3.0E-10
sp|Q9CQ31|ASB11_MOUSE Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 99 296 3.0E-10
sp|O60733|PLPL9_HUMAN 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 175 431 3.0E-10
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 246 395 3.0E-10
sp|Q8WXK4|ASB12_HUMAN Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 213 402 3.0E-10
sp|Q10311|YD58_SCHPO Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 243 423 3.0E-10
sp|Q9J503|V232_FOWPN Putative ankyrin repeat protein FPV232 OS=Fowlpox virus (strain NVSL) GN=FPV232 PE=3 SV=1 148 417 3.0E-10
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 86 232 3.0E-10
sp|Q8IUH5|ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 234 501 3.0E-10
sp|Q8TAK5|GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 251 413 3.0E-10
sp|E9PTT0|ZDH17_RAT Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 234 501 3.0E-10
sp|Q5UPG7|YL091_MIMIV Putative ankyrin repeat protein L91 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L91 PE=3 SV=1 94 415 4.0E-10
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 342 501 4.0E-10
sp|Q8VHS5|ASB16_MOUSE Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 95 251 4.0E-10
sp|Q07E17|ASZ1_MUSPF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 323 488 4.0E-10
sp|A1X154|ASZ1_ECHTE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 329 495 4.0E-10
sp|A1ZBY1|FEM1B_DROME Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 260 491 4.0E-10
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 325 498 4.0E-10
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 79 265 4.0E-10
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 180 385 4.0E-10
sp|Q53RE8|ANR39_HUMAN Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 120 233 4.0E-10
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 215 395 4.0E-10
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 3 304 4.0E-10
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 180 385 4.0E-10
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 311 496 4.0E-10
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 79 265 4.0E-10
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 79 273 4.0E-10
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 251 416 4.0E-10
sp|Q10311|YD58_SCHPO Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 325 510 4.0E-10
sp|Q9WV06|ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 284 445 4.0E-10
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 152 355 4.0E-10
sp|Q5UQY4|YR886_MIMIV Putative ankyrin repeat protein R886 (Fragment) OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R886 PE=4 SV=1 131 237 4.0E-10
sp|Q80TN5|ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 234 501 4.0E-10
sp|Q91974|IKBA_CHICK NF-kappa-B inhibitor alpha OS=Gallus gallus GN=NFKBIA PE=2 SV=1 102 263 4.0E-10
sp|Q876A6|AKR1_NAUCC Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 181 420 4.0E-10
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 279 447 4.0E-10
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 342 501 5.0E-10
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 230 429 5.0E-10
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 325 496 5.0E-10
sp|Q95N27|PP16B_BOVIN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 234 500 5.0E-10
sp|Q2IBE3|ASZ1_PONAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 323 495 5.0E-10
sp|Q07DV3|ASZ1_AOTNA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 81 263 5.0E-10
sp|Q5UQY9|YR896_MIMIV Putative ankyrin repeat protein R896 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R896 PE=3 SV=1 185 338 5.0E-10
sp|Q07DZ7|ASZ1_ORNAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 329 495 5.0E-10
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 245 395 5.0E-10
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 79 273 5.0E-10
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 311 496 5.0E-10
sp|Q5RFS1|ASB11_PONAB Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 211 417 5.0E-10
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 144 317 5.0E-10
sp|Q9WV48|SHAN1_RAT SH3 and multiple ankyrin repeat domains protein 1 OS=Rattus norvegicus GN=Shank1 PE=1 SV=1 75 296 5.0E-10
sp|Q5EA33|ANR49_BOVIN Ankyrin repeat domain-containing protein 49 OS=Bos taurus GN=ANKRD49 PE=2 SV=1 193 297 5.0E-10
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 83 248 5.0E-10
sp|Q8TAK5|GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 86 230 5.0E-10
sp|Q5RCK5|ASB7_PONAB Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 312 511 6.0E-10
sp|Q09YN0|ASZ1_RABIT Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 324 488 6.0E-10
sp|Q8WWH4|ASZ1_HUMAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 288 431 6.0E-10
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 215 417 6.0E-10
sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 218 395 6.0E-10
sp|Q9D2X0|ANR39_MOUSE Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=1 SV=1 152 265 6.0E-10
sp|Q6UB99|ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 171 300 6.0E-10
sp|Q0P5B9|ANR39_BOVIN Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 287 396 6.0E-10
sp|Q96NS5|ASB16_HUMAN Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens GN=ASB16 PE=1 SV=2 166 416 6.0E-10
sp|D3YZU1|SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus GN=Shank1 PE=1 SV=1 75 296 6.0E-10
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 279 418 6.0E-10
sp|Q8WVL7|ANR49_HUMAN Ankyrin repeat domain-containing protein 49 OS=Homo sapiens GN=ANKRD49 PE=1 SV=1 251 363 6.0E-10
sp|Q8N7Z5|ANR31_HUMAN Putative ankyrin repeat domain-containing protein 31 OS=Homo sapiens GN=ANKRD31 PE=5 SV=2 106 218 6.0E-10
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 255 450 7.0E-10
sp|Q5UPB4|YL036_MIMIV Putative ankyrin repeat protein L36 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L36 PE=3 SV=1 151 336 7.0E-10
sp|B0G124|Y9043_DICDI Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 291 428 7.0E-10
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 215 364 7.0E-10
sp|Q8VE42|ANR49_MOUSE Ankyrin repeat domain-containing protein 49 OS=Mus musculus GN=Ankrd49 PE=1 SV=1 193 297 7.0E-10
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 336 496 8.0E-10
sp|Q09YH1|ASZ1_SAIBB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 81 263 8.0E-10
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 147 332 8.0E-10
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 147 332 8.0E-10
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 346 496 8.0E-10
sp|Q6UB99|ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 191 366 8.0E-10
sp|Q8WXH4|ASB11_HUMAN Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 211 417 8.0E-10
sp|Q9WV06|ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 152 318 8.0E-10
sp|Q876A6|AKR1_NAUCC Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 99 297 8.0E-10
sp|P31695|NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 213 431 8.0E-10
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 312 509 9.0E-10
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 336 496 9.0E-10
sp|Q6NLQ8|XB32_ARATH E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 312 506 9.0E-10
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 211 428 9.0E-10
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 346 496 9.0E-10
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 203 385 9.0E-10
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 203 385 9.0E-10
sp|Q52T38|ZDH22_ARATH Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 151 362 9.0E-10
sp|Q9J5I9|V012_FOWPN Putative ankyrin repeat protein FPV012 OS=Fowlpox virus (strain NVSL) GN=FPV012 PE=3 SV=1 212 335 9.0E-10
sp|Q6NXT1|ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 149 316 9.0E-10
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 312 509 1.0E-09
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 50 257 1.0E-09
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 83 248 1.0E-09
sp|Q07E30|ASZ1_NEONE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 323 488 1.0E-09
sp|Q96T49|PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 234 429 1.0E-09
sp|Q8VHQ3|PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=1 SV=1 234 500 1.0E-09
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 99 283 1.0E-09
sp|Q2QLG0|ASZ1_CALJA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 81 263 1.0E-09
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 286 484 1.0E-09
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 255 450 1.0E-09
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 255 450 1.0E-09
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 255 450 1.0E-09
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 211 428 1.0E-09
sp|Q53RE8|ANR39_HUMAN Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 152 265 1.0E-09
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 234 522 1.0E-09
sp|Q4ULZ2|Y580_RICFE Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 124 380 1.0E-09
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 255 450 1.0E-09
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 255 450 1.0E-09
sp|Q9J5G9|V034_FOWPN Putative ankyrin repeat protein FPV034 OS=Fowlpox virus (strain NVSL) GN=ANK2 PE=3 SV=1 325 532 1.0E-09
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 335 533 1.0E-09
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 255 450 1.0E-09
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 255 450 1.0E-09
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 162 352 1.0E-09
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 171 298 1.0E-09
sp|O14593|RFXK_HUMAN DNA-binding protein RFXANK OS=Homo sapiens GN=RFXANK PE=1 SV=2 240 395 1.0E-09
sp|Q8WXK4|ASB12_HUMAN Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 111 270 1.0E-09
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 171 298 1.0E-09
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 143 362 1.0E-09
sp|Q5UQY4|YR886_MIMIV Putative ankyrin repeat protein R886 (Fragment) OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R886 PE=4 SV=1 196 317 1.0E-09
sp|Q8WVL7|ANR49_HUMAN Ankyrin repeat domain-containing protein 49 OS=Homo sapiens GN=ANKRD49 PE=1 SV=1 193 297 1.0E-09
sp|Q80TN5|ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 191 467 1.0E-09
sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 149 266 1.0E-09
sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 149 266 1.0E-09
sp|Q65XV2|XB3_ORYSJ E3 ubiquitin-protein ligase XB3 OS=Oryza sativa subsp. japonica GN=XB3 PE=1 SV=1 240 421 1.0E-09
sp|Q5JPF3|AN36C_HUMAN Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 158 364 1.0E-09
sp|Q99549|MPP8_HUMAN M-phase phosphoprotein 8 OS=Homo sapiens GN=MPHOSPH8 PE=1 SV=2 269 388 1.0E-09
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 342 496 2.0E-09
sp|Q6GPE5|FEM1B_XENLA Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 312 498 2.0E-09
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 46 233 2.0E-09
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 83 237 2.0E-09
sp|Q6ZVH7|ESPNL_HUMAN Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 45 296 2.0E-09
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 37 294 2.0E-09
sp|Q9BZL4|PP12C_HUMAN Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens GN=PPP1R12C PE=1 SV=1 178 366 2.0E-09
sp|Q07DV3|ASZ1_AOTNA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 287 431 2.0E-09
sp|Q09YH1|ASZ1_SAIBB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 287 431 2.0E-09
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 234 465 2.0E-09
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 147 332 2.0E-09
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 255 450 2.0E-09
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 147 332 2.0E-09
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 147 332 2.0E-09
sp|Q53RE8|ANR39_HUMAN Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 287 396 2.0E-09
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 178 346 2.0E-09
sp|Q5UPG0|YL086_MIMIV Putative ankyrin repeat protein L86 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L86 PE=3 SV=1 155 485 2.0E-09
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 279 416 2.0E-09
sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 224 428 2.0E-09
sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 176 383 2.0E-09
sp|Q9D2X0|ANR39_MOUSE Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=1 SV=1 287 396 2.0E-09
sp|Q05753|AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 179 316 2.0E-09
sp|O60733|PLPL9_HUMAN 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 49 266 2.0E-09
sp|O60733|PLPL9_HUMAN 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 50 298 2.0E-09
sp|Q9D738|ASB12_MOUSE Ankyrin repeat and SOCS box protein 12 OS=Mus musculus GN=Asb12 PE=2 SV=1 111 270 2.0E-09
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 292 447 2.0E-09
sp|Q94CT7|XB31_ORYSJ Probable E3 ubiquitin-protein ligase XBOS31 OS=Oryza sativa subsp. japonica GN=XBOS31 PE=2 SV=1 212 403 2.0E-09
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 303 416 2.0E-09
sp|D4A615|TONSL_RAT Tonsoku-like protein OS=Rattus norvegicus GN=Tonsl PE=3 SV=1 175 281 2.0E-09
sp|Q6NZL6|TONSL_MOUSE Tonsoku-like protein OS=Mus musculus GN=Tonsl PE=1 SV=2 175 281 2.0E-09
sp|Q5EA33|ANR49_BOVIN Ankyrin repeat domain-containing protein 49 OS=Bos taurus GN=ANKRD49 PE=2 SV=1 82 198 2.0E-09
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 58 286 2.0E-09
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 58 286 2.0E-09
sp|Q9WV06|ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 309 455 2.0E-09
sp|Q5UQI8|YR837_MIMIV Putative ankyrin repeat protein R837 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R837 PE=3 SV=1 122 296 2.0E-09
sp|Q8IUH5|ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 191 467 2.0E-09
sp|Q5UQF2|YL482_MIMIV Putative ankyrin repeat protein L482 (Fragment) OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L482 PE=4 SV=1 281 397 2.0E-09
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 329 484 2.0E-09
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 194 347 2.0E-09
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 181 315 2.0E-09
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 329 484 2.0E-09
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 181 315 2.0E-09
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 115 250 2.0E-09
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 279 418 2.0E-09
sp|P31695|NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 50 405 2.0E-09
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 257 464 3.0E-09
sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 115 355 3.0E-09
sp|Q07DY6|ASZ1_COLGU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 323 495 3.0E-09
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 104 274 3.0E-09
sp|Q9QW30|NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 224 428 3.0E-09
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 242 495 3.0E-09
sp|Q0P5B9|ANR39_BOVIN Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 120 233 3.0E-09
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 98 269 3.0E-09
sp|Q1RI12|Y921_RICBR Putative ankyrin repeat protein RBE_0921 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0921 PE=3 SV=1 159 386 3.0E-09
sp|P77736|YAHD_ECOLI Putative ankyrin repeat protein YahD OS=Escherichia coli (strain K12) GN=yahD PE=3 SV=1 85 268 3.0E-09
sp|Q9Z205|RFXK_MOUSE DNA-binding protein RFXANK OS=Mus musculus GN=Rfxank PE=2 SV=1 240 395 3.0E-09
sp|Q5UPD5|YL059_MIMIV Putative ankyrin repeat protein L59 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L59 PE=3 SV=1 80 396 3.0E-09
sp|Q876L5|AKR1_SACU7 Palmitoyltransferase AKR1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AKR1 PE=3 SV=2 115 329 3.0E-09
sp|Q5UQ04|YR791_MIMIV Putative ankyrin repeat protein R791 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R791 PE=3 SV=1 196 408 3.0E-09
sp|Q9TU71|ANKR1_RABIT Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 171 347 3.0E-09
sp|Q04861|NFKB1_CHICK Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus GN=NFKB1 PE=2 SV=2 175 340 3.0E-09
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 279 420 3.0E-09
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 194 347 3.0E-09
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 83 304 4.0E-09
sp|Q9J5I7|V014_FOWPN Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 258 498 4.0E-09
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 145 498 4.0E-09
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 262 496 4.0E-09
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 211 428 4.0E-09
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 211 428 4.0E-09
sp|Q9D2X0|ANR39_MOUSE Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=1 SV=1 120 233 4.0E-09
sp|Q05753|AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 131 283 4.0E-09
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 144 312 4.0E-09
sp|Q8TF21|ANR24_HUMAN Ankyrin repeat domain-containing protein 24 OS=Homo sapiens GN=ANKRD24 PE=2 SV=2 309 479 4.0E-09
sp|Q99PE2|ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 171 298 4.0E-09
sp|A9JR78|TONSL_DANRE Tonsoku-like protein OS=Danio rerio GN=tonsl PE=2 SV=1 107 215 4.0E-09
sp|Q865U8|ANKR1_PIG Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 171 347 4.0E-09
sp|Q9BGT9|ASB7_MACFA Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 287 471 5.0E-09
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 335 498 5.0E-09
sp|Q2QL84|ASZ1_MICMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 267 488 5.0E-09
sp|Q5UP19|YR864_MIMIV Putative ankyrin repeat protein R864 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L864 PE=3 SV=1 46 204 5.0E-09
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 176 327 5.0E-09
sp|Q91ZT8|ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 211 413 5.0E-09
sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 207 416 5.0E-09
sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 227 395 5.0E-09
sp|Q9Z205|RFXK_MOUSE DNA-binding protein RFXANK OS=Mus musculus GN=Rfxank PE=2 SV=1 76 247 5.0E-09
sp|Q10311|YD58_SCHPO Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 183 385 5.0E-09
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 303 416 5.0E-09
sp|Q4P6L3|AKR1_USTMA Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 275 495 5.0E-09
sp|Q99PE2|ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 303 416 5.0E-09
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 310 413 5.0E-09
sp|E9PTT0|ZDH17_RAT Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 191 467 5.0E-09
sp|Q94B55|XB31_ARATH Putative E3 ubiquitin-protein ligase XBAT31 OS=Arabidopsis thaliana GN=XBAT31 PE=2 SV=1 143 302 5.0E-09
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 147 318 6.0E-09
sp|Q6UB99|ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 145 251 6.0E-09
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 284 445 6.0E-09
sp|Q8N7Z5|ANR31_HUMAN Putative ankyrin repeat domain-containing protein 31 OS=Homo sapiens GN=ANKRD31 PE=5 SV=2 310 416 6.0E-09
sp|Q9H672|ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 287 465 7.0E-09
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 51 205 7.0E-09
sp|Q96I34|PP16A_HUMAN Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens GN=PPP1R16A PE=1 SV=1 144 364 7.0E-09
sp|Q9Y6X6|MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 132 340 7.0E-09
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 147 332 7.0E-09
sp|Q9J5I3|V018_FOWPN Putative ankyrin repeat protein FPV018 OS=Fowlpox virus (strain NVSL) GN=FPV018 PE=3 SV=1 86 407 7.0E-09
sp|Q9J5I3|V018_FOWPN Putative ankyrin repeat protein FPV018 OS=Fowlpox virus (strain NVSL) GN=FPV018 PE=3 SV=1 192 496 7.0E-09
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 147 332 7.0E-09
sp|Q05753|AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 295 447 7.0E-09
sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 224 428 7.0E-09
sp|Q9Y574|ASB4_HUMAN Ankyrin repeat and SOCS box protein 4 OS=Homo sapiens GN=ASB4 PE=2 SV=1 246 447 7.0E-09
sp|Q9CQ31|ASB11_MOUSE Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 211 416 7.0E-09
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 368 538 7.0E-09
sp|Q5EA33|ANR49_BOVIN Ankyrin repeat domain-containing protein 49 OS=Bos taurus GN=ANKRD49 PE=2 SV=1 248 363 7.0E-09
sp|Q9WV06|ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 147 285 7.0E-09
sp|Q6ZVZ8|ASB18_HUMAN Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens GN=ASB18 PE=2 SV=2 246 447 7.0E-09
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 171 347 7.0E-09
sp|Q8WVL7|ANR49_HUMAN Ankyrin repeat domain-containing protein 49 OS=Homo sapiens GN=ANKRD49 PE=1 SV=1 82 198 7.0E-09
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 366 498 8.0E-09
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 147 332 8.0E-09
sp|Q4FE45|XB33_ARATH E3 ubiquitin-protein ligase XBAT33 OS=Arabidopsis thaliana GN=XBAT33 PE=2 SV=1 115 317 8.0E-09
sp|Q05753|AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 191 347 8.0E-09
sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 192 362 8.0E-09
sp|O90760|V031_FOWPN Putative ankyrin repeat protein FPV031 OS=Fowlpox virus (strain NVSL) GN=ANK3 PE=3 SV=1 281 429 8.0E-09
sp|Q5UPI6|YL112_MIMIV Putative ankyrin repeat protein L112 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L112 PE=4 SV=1 147 509 8.0E-09
sp|Q09YH1|ASZ1_SAIBB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 323 495 9.0E-09
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 147 332 9.0E-09
sp|Q5UPD9|YL066_MIMIV Putative ankyrin repeat protein L66 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L66 PE=3 SV=1 68 399 9.0E-09
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 147 332 9.0E-09
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 149 329 9.0E-09
sp|Q6C520|AKR1_YARLI Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 51 253 9.0E-09
sp|Q5UQJ0|YR835_MIMIV Putative ankyrin repeat protein R835 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R835 PE=3 SV=1 248 396 9.0E-09
sp|Q9CWU2|ZDH13_MOUSE Palmitoyltransferase ZDHHC13 OS=Mus musculus GN=Zdhhc13 PE=1 SV=2 251 495 9.0E-09
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 53 257 1.0E-08
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 347 533 1.0E-08
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 45 243 1.0E-08
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 342 501 1.0E-08
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 84 294 1.0E-08
sp|Q07E43|ASZ1_DASNO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 323 488 1.0E-08
sp|Q5UP14|YR845_MIMIV Putative ankyrin repeat protein R845 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R845 PE=3 SV=1 260 465 1.0E-08
sp|Q5UPU4|YR267_MIMIV Putative ankyrin repeat protein R267 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R267 PE=3 SV=1 46 296 1.0E-08
sp|Q2QLH1|ASZ1_OTOGA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Otolemur garnettii GN=ASZ1 PE=3 SV=1 323 488 1.0E-08
sp|Q07DY6|ASZ1_COLGU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 94 263 1.0E-08
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 343 496 1.0E-08
sp|Q2IBG0|ASZ1_EULMM Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 323 488 1.0E-08
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 209 383 1.0E-08
sp|Q2QLG0|ASZ1_CALJA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 329 495 1.0E-08
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 213 329 1.0E-08
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 177 418 1.0E-08
sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 346 491 1.0E-08
sp|Q8WXI3|ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 279 498 1.0E-08
sp|Q6UB99|ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 115 234 1.0E-08
sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 277 436 1.0E-08
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 176 352 1.0E-08
sp|Q96HA7|TONSL_HUMAN Tonsoku-like protein OS=Homo sapiens GN=TONSL PE=1 SV=2 167 281 1.0E-08
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 244 373 1.0E-08
sp|O90760|V031_FOWPN Putative ankyrin repeat protein FPV031 OS=Fowlpox virus (strain NVSL) GN=ANK3 PE=3 SV=1 314 470 1.0E-08
sp|Q5UPD5|YL059_MIMIV Putative ankyrin repeat protein L59 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L59 PE=3 SV=1 246 496 1.0E-08
sp|Q5UPB6|YL045_MIMIV Putative ankyrin repeat protein L45 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L45 PE=3 SV=1 116 235 1.0E-08
sp|Q4P6L3|AKR1_USTMA Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 182 385 1.0E-08
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 63 270 1.0E-08
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 63 270 1.0E-08
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 144 317 1.0E-08
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 329 482 1.0E-08
sp|Q8VE42|ANR49_MOUSE Ankyrin repeat domain-containing protein 49 OS=Mus musculus GN=Ankrd49 PE=1 SV=1 120 219 1.0E-08
sp|Q8T2Q0|ZDHC6_DICDI Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 115 289 1.0E-08
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 51 236 2.0E-08
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 33 268 2.0E-08
sp|Q9TXQ1|TNKS1_CAEEL Tankyrase-like protein OS=Caenorhabditis elegans GN=tank-1 PE=2 SV=1 142 408 2.0E-08
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 83 234 2.0E-08
sp|Q09YK6|ASZ1_ATEGE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ateles geoffroyi GN=ASZ1 PE=3 SV=1 323 491 2.0E-08
sp|Q8WMX6|ASZ1_PANTR Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 81 263 2.0E-08
sp|Q2QLG0|ASZ1_CALJA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 287 431 2.0E-08
sp|Q4JHE0|XB36_ORYSJ Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 275 473 2.0E-08
sp|Q5UPG0|YL086_MIMIV Putative ankyrin repeat protein L86 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L86 PE=3 SV=1 175 538 2.0E-08
sp|Q0P5B9|ANR39_BOVIN Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 184 305 2.0E-08
sp|O60733|PLPL9_HUMAN 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 140 330 2.0E-08
sp|Q0P5G1|TONSL_BOVIN Tonsoku-like protein OS=Bos taurus GN=TONSL PE=2 SV=1 190 281 2.0E-08
sp|Q9J5I9|V012_FOWPN Putative ankyrin repeat protein FPV012 OS=Fowlpox virus (strain NVSL) GN=FPV012 PE=3 SV=1 141 283 2.0E-08
sp|Q9J5I9|V012_FOWPN Putative ankyrin repeat protein FPV012 OS=Fowlpox virus (strain NVSL) GN=FPV012 PE=3 SV=1 77 205 2.0E-08
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 244 361 2.0E-08
sp|Q5UQY4|YR886_MIMIV Putative ankyrin repeat protein R886 (Fragment) OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R886 PE=4 SV=1 328 441 2.0E-08
sp|Q8TAK5|GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 215 364 2.0E-08
sp|Q865U8|ANKR1_PIG Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 113 250 2.0E-08
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 50 231 3.0E-08
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 80 234 3.0E-08
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 347 498 3.0E-08
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 65 316 3.0E-08
sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 329 508 3.0E-08
sp|Q5UQY9|YR896_MIMIV Putative ankyrin repeat protein R896 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R896 PE=3 SV=1 51 237 3.0E-08
sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 329 508 3.0E-08
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 119 271 3.0E-08
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 103 230 3.0E-08
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 335 496 3.0E-08
sp|Q96NS5|ASB16_HUMAN Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens GN=ASB16 PE=1 SV=2 61 251 3.0E-08
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 308 508 3.0E-08
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 213 364 3.0E-08
sp|Q6C520|AKR1_YARLI Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 255 487 3.0E-08
sp|O14593|RFXK_HUMAN DNA-binding protein RFXANK OS=Homo sapiens GN=RFXANK PE=1 SV=2 287 416 3.0E-08
sp|Q5UQJ0|YR835_MIMIV Putative ankyrin repeat protein R835 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R835 PE=3 SV=1 258 468 3.0E-08
sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 105 340 3.0E-08
sp|Q8TF21|ANR24_HUMAN Ankyrin repeat domain-containing protein 24 OS=Homo sapiens GN=ANKRD24 PE=2 SV=2 215 402 3.0E-08
sp|Q86U10|LPP60_HUMAN 60 kDa lysophospholipase OS=Homo sapiens GN=ASPG PE=2 SV=3 217 362 3.0E-08
sp|Q5UPE2|YL063_MIMIV Putative ankyrin repeat protein L63 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L63 PE=3 SV=1 46 202 4.0E-08
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 83 234 4.0E-08
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 380 498 4.0E-08
sp|Q4ULZ2|Y580_RICFE Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 288 496 4.0E-08
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 147 332 4.0E-08
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 147 332 4.0E-08
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 215 417 4.0E-08
sp|Q54LF0|SIR2B_DICDI NAD-dependent deacetylase sir2B OS=Dictyostelium discoideum GN=sir2B PE=2 SV=1 146 498 4.0E-08
sp|Q1RI12|Y921_RICBR Putative ankyrin repeat protein RBE_0921 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0921 PE=3 SV=1 125 413 4.0E-08
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 252 395 4.0E-08
sp|Q4I8B6|AKR1_GIBZE Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 153 352 4.0E-08
sp|Q8TF21|ANR24_HUMAN Ankyrin repeat domain-containing protein 24 OS=Homo sapiens GN=ANKRD24 PE=2 SV=2 178 346 4.0E-08
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 252 395 4.0E-08
sp|Q5UQI8|YR837_MIMIV Putative ankyrin repeat protein R837 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R837 PE=3 SV=1 124 306 4.0E-08
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 248 414 4.0E-08
sp|P25963|IKBA_HUMAN NF-kappa-B inhibitor alpha OS=Homo sapiens GN=NFKBIA PE=1 SV=1 192 364 4.0E-08
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 53 218 5.0E-08
sp|Q07DV3|ASZ1_AOTNA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 323 495 5.0E-08
sp|Q10728|MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 329 508 5.0E-08
sp|Q5UPB9|YL042_MIMIV Putative ankyrin repeat protein L42 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L42 PE=3 SV=1 65 300 5.0E-08
sp|O90760|V031_FOWPN Putative ankyrin repeat protein FPV031 OS=Fowlpox virus (strain NVSL) GN=ANK3 PE=3 SV=1 242 397 5.0E-08
sp|B0G124|Y9043_DICDI Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 149 293 5.0E-08
sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 152 455 6.0E-08
sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 110 296 6.0E-08
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 87 286 6.0E-08
sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 83 185 6.0E-08
sp|Q99PE2|ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 252 383 6.0E-08
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 213 412 6.0E-08
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 147 286 7.0E-08
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 149 317 7.0E-08
sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 83 294 7.0E-08
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 311 465 7.0E-08
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 156 416 7.0E-08
sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 245 501 7.0E-08
sp|Q4I8B6|AKR1_GIBZE Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 59 253 7.0E-08
sp|Q5UPI6|YL112_MIMIV Putative ankyrin repeat protein L112 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L112 PE=4 SV=1 158 512 7.0E-08
sp|Q9TU71|ANKR1_RABIT Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 115 250 7.0E-08
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 376 498 8.0E-08
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 115 251 8.0E-08
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 249 463 8.0E-08
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 373 476 8.0E-08
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 284 428 8.0E-08
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 113 250 8.0E-08
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 366 496 9.0E-08
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 302 487 9.0E-08
sp|Q4FE45|XB33_ARATH E3 ubiquitin-protein ligase XBAT33 OS=Arabidopsis thaliana GN=XBAT33 PE=2 SV=1 83 251 9.0E-08
sp|Q0P5B9|ANR39_BOVIN Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 217 341 9.0E-08
sp|Q5UPB6|YL045_MIMIV Putative ankyrin repeat protein L45 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L45 PE=3 SV=1 58 204 9.0E-08
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 153 352 9.0E-08
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 327 460 9.0E-08
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 265 476 9.0E-08
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 112 229 1.0E-07
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 309 478 1.0E-07
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 314 496 1.0E-07
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 50 262 1.0E-07
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 180 499 1.0E-07
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 370 511 1.0E-07
sp|Q9BSK4|FEM1A_HUMAN Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 343 555 1.0E-07
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 366 496 1.0E-07
sp|Q4JHE0|XB36_ORYSJ Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 52 222 1.0E-07
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 103 264 1.0E-07
sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 243 484 1.0E-07
sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 164 429 1.0E-07
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 312 451 1.0E-07
sp|Q7XUW4|KOR2_ORYSJ Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 215 398 1.0E-07
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 55 197 1.0E-07
sp|D4A615|TONSL_RAT Tonsoku-like protein OS=Rattus norvegicus GN=Tonsl PE=3 SV=1 145 248 1.0E-07
sp|Q5XJ13|ANKS6_DANRE Ankyrin repeat and SAM domain-containing protein 6 OS=Danio rerio GN=anks6 PE=2 SV=1 277 496 1.0E-07
sp|Q6NZL6|TONSL_MOUSE Tonsoku-like protein OS=Mus musculus GN=Tonsl PE=1 SV=2 145 248 1.0E-07
sp|Q10311|YD58_SCHPO Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 92 286 1.0E-07
sp|Q9J5I9|V012_FOWPN Putative ankyrin repeat protein FPV012 OS=Fowlpox virus (strain NVSL) GN=FPV012 PE=3 SV=1 266 401 1.0E-07
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 178 308 1.0E-07
sp|Q5UQY4|YR886_MIMIV Putative ankyrin repeat protein R886 (Fragment) OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R886 PE=4 SV=1 295 401 1.0E-07
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 148 268 1.0E-07
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 323 455 1.0E-07
sp|Q8VE42|ANR49_MOUSE Ankyrin repeat domain-containing protein 49 OS=Mus musculus GN=Ankrd49 PE=1 SV=1 324 446 1.0E-07
sp|Q8T2Q0|ZDHC6_DICDI Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 363 528 1.0E-07
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 142 303 1.0E-07
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 147 268 1.0E-07
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 244 343 1.0E-07
sp|Q65XV2|XB3_ORYSJ E3 ubiquitin-protein ligase XB3 OS=Oryza sativa subsp. japonica GN=XB3 PE=1 SV=1 215 403 1.0E-07
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 13 198 2.0E-07
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 51 226 2.0E-07
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 51 226 2.0E-07
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 50 262 2.0E-07
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 50 262 2.0E-07
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 394 499 2.0E-07
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 51 267 2.0E-07
sp|Q9Z2G1|FM1AA_MOUSE Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 343 542 2.0E-07
sp|Q4V890|FEM1A_RAT Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 343 542 2.0E-07
sp|Q6NLQ8|XB32_ARATH E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 323 512 2.0E-07
sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 329 508 2.0E-07
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 380 498 2.0E-07
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 98 384 2.0E-07
sp|Q9J5H8|V023_FOWPN Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 99 263 2.0E-07
sp|Q53RE8|ANR39_HUMAN Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 184 305 2.0E-07
sp|Q53RE8|ANR39_HUMAN Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 114 210 2.0E-07
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 253 488 2.0E-07
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 380 498 2.0E-07
sp|Q9QW30|NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 243 429 2.0E-07
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 147 345 2.0E-07
sp|Q0P5B9|ANR39_BOVIN Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 382 515 2.0E-07
sp|Q94CT7|XB31_ORYSJ Probable E3 ubiquitin-protein ligase XBOS31 OS=Oryza sativa subsp. japonica GN=XBOS31 PE=2 SV=1 243 421 2.0E-07
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 279 409 2.0E-07
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 284 428 2.0E-07
sp|O14593|RFXK_HUMAN DNA-binding protein RFXANK OS=Homo sapiens GN=RFXANK PE=1 SV=2 114 242 2.0E-07
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 315 496 2.0E-07
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 315 496 2.0E-07
sp|Q641X1|ANR61_RAT Ankyrin repeat domain-containing protein 61 OS=Rattus norvegicus GN=Ankrd61 PE=2 SV=1 104 266 2.0E-07
sp|B0G124|Y9043_DICDI Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 182 301 2.0E-07
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 83 263 2.0E-07
sp|Q8TAK5|GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 347 460 2.0E-07
sp|Q8TAK5|GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 284 428 2.0E-07
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 142 377 2.0E-07
sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 317 423 2.0E-07
sp|Q91974|IKBA_CHICK NF-kappa-B inhibitor alpha OS=Gallus gallus GN=NFKBIA PE=2 SV=1 279 415 2.0E-07
sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 317 423 2.0E-07
sp|Q5JPF3|AN36C_HUMAN Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 312 502 2.0E-07
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 394 499 3.0E-07
sp|Q91ZU0|ASB7_MOUSE Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 255 484 3.0E-07
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 347 489 3.0E-07
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 144 306 3.0E-07
sp|Q9D2X0|ANR39_MOUSE Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=1 SV=1 184 305 3.0E-07
sp|Q7EZ44|XB35_ORYSJ Probable E3 ubiquitin-protein ligase XBOS35 OS=Oryza sativa subsp. japonica GN=XBOS35 PE=2 SV=1 248 505 3.0E-07
sp|Q8BG95|MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus GN=Ppp1r12b PE=1 SV=2 327 499 3.0E-07
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 82 237 3.0E-07
sp|Q5UPR3|YR777_MIMIV Putative ankyrin repeat protein R777 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R777 PE=3 SV=1 192 401 3.0E-07
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 114 237 3.0E-07
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 55 197 3.0E-07
sp|Q4P6L3|AKR1_USTMA Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 111 317 3.0E-07
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 87 286 3.0E-07
sp|Q8T2Q0|ZDHC6_DICDI Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 330 498 3.0E-07
sp|P39010|AKR1_YEAST Palmitoyltransferase AKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKR1 PE=1 SV=1 323 496 3.0E-07
sp|Q6NXT1|ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 317 423 3.0E-07
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 244 373 3.0E-07
sp|Q876A6|AKR1_NAUCC Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 251 444 3.0E-07
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 370 511 4.0E-07
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 391 499 4.0E-07
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 391 499 4.0E-07
sp|Q9J5H5|V026_FOWPN Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 38 235 4.0E-07
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 347 489 4.0E-07
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 132 387 4.0E-07
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 347 489 4.0E-07
sp|Q7EZ44|XB35_ORYSJ Probable E3 ubiquitin-protein ligase XBOS35 OS=Oryza sativa subsp. japonica GN=XBOS35 PE=2 SV=1 28 232 4.0E-07
sp|Q9Z2F6|BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 213 416 4.0E-07
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 107 266 4.0E-07
sp|Q5UPV1|YL271_MIMIV Putative ankyrin repeat protein L271 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L271 PE=3 SV=1 185 480 4.0E-07
sp|P25963|IKBA_HUMAN NF-kappa-B inhibitor alpha OS=Homo sapiens GN=NFKBIA PE=1 SV=1 279 416 4.0E-07
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 324 480 5.0E-07
sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 280 512 5.0E-07
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 394 499 5.0E-07
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 80 233 5.0E-07
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 394 499 5.0E-07
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 391 499 5.0E-07
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 391 499 5.0E-07
sp|Q96AX9|MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 84 294 5.0E-07
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 394 499 5.0E-07
sp|Q3KP44|ANR55_HUMAN Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 152 428 5.0E-07
sp|Q6KAE5|XB32_ORYSJ Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 323 512 5.0E-07
sp|Q07DZ7|ASZ1_ORNAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 281 445 5.0E-07
sp|Q53RE8|ANR39_HUMAN Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 244 341 5.0E-07
sp|Q9D2X0|ANR39_MOUSE Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=1 SV=1 114 210 5.0E-07
sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 293 447 5.0E-07
sp|Q9Z2F6|BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 138 261 5.0E-07
sp|Q6C520|AKR1_YARLI Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 116 318 5.0E-07
sp|Q641X1|ANR61_RAT Ankyrin repeat domain-containing protein 61 OS=Rattus norvegicus GN=Ankrd61 PE=2 SV=1 171 440 5.0E-07
sp|Q6NXT1|ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 251 353 5.0E-07
sp|P25963|IKBA_HUMAN NF-kappa-B inhibitor alpha OS=Homo sapiens GN=NFKBIA PE=1 SV=1 106 251 5.0E-07
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 315 476 5.0E-07
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 346 533 6.0E-07
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 394 499 6.0E-07
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 394 499 6.0E-07
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 394 499 6.0E-07
sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 49 267 6.0E-07
sp|Q337A0|XB33_ORYSJ Probable E3 ubiquitin-protein ligase XBOS33 OS=Oryza sativa subsp. japonica GN=XBOS33 PE=2 SV=1 326 496 6.0E-07
sp|Q6DRG7|MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 329 508 6.0E-07
sp|Q4ULZ2|Y580_RICFE Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 255 464 6.0E-07
sp|Q05753|AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 105 263 6.0E-07
sp|Q58CT0|DYH12_BOVIN Dynein heavy chain 12, axonemal OS=Bos taurus GN=DNAH12 PE=2 SV=1 131 341 6.0E-07
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 185 347 6.0E-07
sp|D4A615|TONSL_RAT Tonsoku-like protein OS=Rattus norvegicus GN=Tonsl PE=3 SV=1 99 184 6.0E-07
sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 251 353 6.0E-07
sp|Q9Z1P7|KANK3_MOUSE KN motif and ankyrin repeat domain-containing protein 3 OS=Mus musculus GN=Kank3 PE=1 SV=1 243 412 6.0E-07
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 147 268 6.0E-07
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 394 499 7.0E-07
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 394 499 7.0E-07
sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 98 251 7.0E-07
sp|Q9CQ31|ASB11_MOUSE Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 256 501 7.0E-07
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 115 286 7.0E-07
sp|Q6NZL6|TONSL_MOUSE Tonsoku-like protein OS=Mus musculus GN=Tonsl PE=1 SV=2 99 184 7.0E-07
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 312 478 7.0E-07
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 312 478 7.0E-07
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 347 460 7.0E-07
sp|Q8WVL7|ANR49_HUMAN Ankyrin repeat domain-containing protein 49 OS=Homo sapiens GN=ANKRD49 PE=1 SV=1 120 219 7.0E-07
sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 251 353 7.0E-07
sp|Q29RM5|FEM1A_BOVIN Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 342 551 8.0E-07
sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 98 251 8.0E-07
sp|Q4JHE0|XB36_ORYSJ Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 305 465 8.0E-07
sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 218 391 8.0E-07
sp|Q0P5G1|TONSL_BOVIN Tonsoku-like protein OS=Bos taurus GN=TONSL PE=2 SV=1 82 184 8.0E-07
sp|A9JR78|TONSL_DANRE Tonsoku-like protein OS=Danio rerio GN=tonsl PE=2 SV=1 175 281 8.0E-07
sp|Q8VE42|ANR49_MOUSE Ankyrin repeat domain-containing protein 49 OS=Mus musculus GN=Ankrd49 PE=1 SV=1 224 350 8.0E-07
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 370 511 9.0E-07
sp|Q10728|MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 98 251 9.0E-07
sp|Q53RE8|ANR39_HUMAN Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 382 515 9.0E-07
sp|Q9D2X0|ANR39_MOUSE Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=1 SV=1 244 360 9.0E-07
sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 245 501 9.0E-07
sp|P77736|YAHD_ECOLI Putative ankyrin repeat protein YahD OS=Escherichia coli (strain K12) GN=yahD PE=3 SV=1 283 464 9.0E-07
sp|Q99PE2|ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 114 237 9.0E-07
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 103 273 9.0E-07
sp|Q8WVL7|ANR49_HUMAN Ankyrin repeat domain-containing protein 49 OS=Homo sapiens GN=ANKRD49 PE=1 SV=1 324 456 9.0E-07
sp|Q04861|NFKB1_CHICK Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus GN=NFKB1 PE=2 SV=2 176 373 9.0E-07
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 13 198 1.0E-06
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 346 533 1.0E-06
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 83 237 1.0E-06
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 51 164 1.0E-06
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 394 499 1.0E-06
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 394 535 1.0E-06
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 394 499 1.0E-06
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 394 499 1.0E-06
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 80 233 1.0E-06
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 394 499 1.0E-06
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 394 499 1.0E-06
sp|Q6NLQ8|XB32_ARATH E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 49 221 1.0E-06
sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 347 429 1.0E-06
sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 347 429 1.0E-06
sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 347 429 1.0E-06
sp|O60237|MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens GN=PPP1R12B PE=1 SV=2 98 296 1.0E-06
sp|Q10728|MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 347 429 1.0E-06
sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 143 272 1.0E-06
sp|Q9D2X0|ANR39_MOUSE Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=1 SV=1 382 515 1.0E-06
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 117 339 1.0E-06
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 347 460 1.0E-06
sp|Q9Z205|RFXK_MOUSE DNA-binding protein RFXANK OS=Mus musculus GN=Rfxank PE=2 SV=1 51 164 1.0E-06
sp|Q9Z205|RFXK_MOUSE DNA-binding protein RFXANK OS=Mus musculus GN=Rfxank PE=2 SV=1 299 416 1.0E-06
sp|Q5UPB6|YL045_MIMIV Putative ankyrin repeat protein L45 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L45 PE=3 SV=1 90 235 1.0E-06
sp|Q99PE2|ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 55 195 1.0E-06
sp|Q641X1|ANR61_RAT Ankyrin repeat domain-containing protein 61 OS=Rattus norvegicus GN=Ankrd61 PE=2 SV=1 130 283 1.0E-06
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 210 302 1.0E-06
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 82 170 1.0E-06
sp|B0G124|Y9043_DICDI Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 380 501 1.0E-06
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 345 496 1.0E-06
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 347 535 1.0E-06
sp|Q8N7Z5|ANR31_HUMAN Putative ankyrin repeat domain-containing protein 31 OS=Homo sapiens GN=ANKRD31 PE=5 SV=2 200 302 1.0E-06
sp|Q6NXT1|ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 201 318 1.0E-06
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 354 496 2.0E-06
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 280 450 2.0E-06
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 394 499 2.0E-06
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 51 164 2.0E-06
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 212 498 2.0E-06
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 394 499 2.0E-06
sp|Q9TXQ1|TNKS1_CAEEL Tankyrase-like protein OS=Caenorhabditis elegans GN=tank-1 PE=2 SV=1 279 487 2.0E-06
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 368 512 2.0E-06
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 302 496 2.0E-06
sp|Q6DRG7|MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 101 251 2.0E-06
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 311 447 2.0E-06
sp|P14360|V240_FOWPN Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 288 496 2.0E-06
sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 335 486 2.0E-06
sp|Q9QW30|NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 335 486 2.0E-06
sp|Q8BG95|MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus GN=Ppp1r12b PE=1 SV=2 98 265 2.0E-06
sp|Q0P5B9|ANR39_BOVIN Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 79 210 2.0E-06
sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 335 486 2.0E-06
sp|Q5RFS1|ASB11_PONAB Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 256 483 2.0E-06
sp|Q9BXX2|AN30B_HUMAN Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 155 369 2.0E-06
sp|Q9Z2F6|BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 176 383 2.0E-06
sp|Q99466|NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 243 503 2.0E-06
sp|Q96HA7|TONSL_HUMAN Tonsoku-like protein OS=Homo sapiens GN=TONSL PE=1 SV=2 170 315 2.0E-06
sp|D4A615|TONSL_RAT Tonsoku-like protein OS=Rattus norvegicus GN=Tonsl PE=3 SV=1 213 315 2.0E-06
sp|D4A615|TONSL_RAT Tonsoku-like protein OS=Rattus norvegicus GN=Tonsl PE=3 SV=1 244 347 2.0E-06
sp|Q4I8B6|AKR1_GIBZE Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 288 455 2.0E-06
sp|Q6NZL6|TONSL_MOUSE Tonsoku-like protein OS=Mus musculus GN=Tonsl PE=1 SV=2 213 315 2.0E-06
sp|Q5EA33|ANR49_BOVIN Ankyrin repeat domain-containing protein 49 OS=Bos taurus GN=ANKRD49 PE=2 SV=1 324 449 2.0E-06
sp|Q5EA33|ANR49_BOVIN Ankyrin repeat domain-containing protein 49 OS=Bos taurus GN=ANKRD49 PE=2 SV=1 120 219 2.0E-06
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 279 445 2.0E-06
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 279 445 2.0E-06
sp|Q9J5I9|V012_FOWPN Putative ankyrin repeat protein FPV012 OS=Fowlpox virus (strain NVSL) GN=FPV012 PE=3 SV=1 372 496 2.0E-06
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 361 496 2.0E-06
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 379 513 2.0E-06
sp|Q8N2N9|AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 288 549 2.0E-06
sp|Q876L5|AKR1_SACU7 Palmitoyltransferase AKR1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AKR1 PE=3 SV=2 350 496 2.0E-06
sp|Q86U10|LPP60_HUMAN 60 kDa lysophospholipase OS=Homo sapiens GN=ASPG PE=2 SV=3 284 433 2.0E-06
sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 201 318 2.0E-06
sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 182 285 2.0E-06
sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 201 318 2.0E-06
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 260 413 2.0E-06
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 160 316 2.0E-06
sp|Q99549|MPP8_HUMAN M-phase phosphoprotein 8 OS=Homo sapiens GN=MPHOSPH8 PE=1 SV=2 218 332 2.0E-06
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 371 483 3.0E-06
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 49 264 3.0E-06
sp|Q9H672|ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 359 499 3.0E-06
sp|Q9BGT9|ASB7_MACFA Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 359 499 3.0E-06
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 83 212 3.0E-06
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 33 205 3.0E-06
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 369 501 3.0E-06
sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 334 496 3.0E-06
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 383 513 3.0E-06
sp|Q4FE45|XB33_ARATH E3 ubiquitin-protein ligase XBAT33 OS=Arabidopsis thaliana GN=XBAT33 PE=2 SV=1 326 499 3.0E-06
sp|Q8BG95|MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus GN=Ppp1r12b PE=1 SV=2 347 429 3.0E-06
sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 328 464 3.0E-06
sp|Q8WXH4|ASB11_HUMAN Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 256 483 3.0E-06
sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 347 488 3.0E-06
sp|Q96HA7|TONSL_HUMAN Tonsoku-like protein OS=Homo sapiens GN=TONSL PE=1 SV=2 277 381 3.0E-06
sp|Q96HA7|TONSL_HUMAN Tonsoku-like protein OS=Homo sapiens GN=TONSL PE=1 SV=2 244 347 3.0E-06
sp|Q96HA7|TONSL_HUMAN Tonsoku-like protein OS=Homo sapiens GN=TONSL PE=1 SV=2 99 184 3.0E-06
sp|Q94CT7|XB31_ORYSJ Probable E3 ubiquitin-protein ligase XBOS31 OS=Oryza sativa subsp. japonica GN=XBOS31 PE=2 SV=1 304 533 3.0E-06
sp|O14593|RFXK_HUMAN DNA-binding protein RFXANK OS=Homo sapiens GN=RFXANK PE=1 SV=2 51 164 3.0E-06
sp|Q8WXK4|ASB12_HUMAN Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 276 402 3.0E-06
sp|Q6NZL6|TONSL_MOUSE Tonsoku-like protein OS=Mus musculus GN=Tonsl PE=1 SV=2 244 347 3.0E-06
sp|Q5EA33|ANR49_BOVIN Ankyrin repeat domain-containing protein 49 OS=Bos taurus GN=ANKRD49 PE=2 SV=1 281 396 3.0E-06
sp|A9JR78|TONSL_DANRE Tonsoku-like protein OS=Danio rerio GN=tonsl PE=2 SV=1 209 314 3.0E-06
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 86 303 3.0E-06
sp|P39010|AKR1_YEAST Palmitoyltransferase AKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKR1 PE=1 SV=1 98 261 3.0E-06
sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 182 285 3.0E-06
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 61 170 3.0E-06
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 52 170 3.0E-06
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 260 413 3.0E-06
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 380 535 4.0E-06
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 380 535 4.0E-06
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 53 235 4.0E-06
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 279 544 4.0E-06
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 307 532 4.0E-06
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 83 212 4.0E-06
sp|Q91ZU0|ASB7_MOUSE Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 359 499 4.0E-06
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 115 251 4.0E-06
sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 98 294 4.0E-06
sp|O60237|MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens GN=PPP1R12B PE=1 SV=2 347 429 4.0E-06
sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 98 215 4.0E-06
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 361 527 4.0E-06
sp|Q9Z2F6|BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 98 294 4.0E-06
sp|Q4I8B6|AKR1_GIBZE Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 144 312 4.0E-06
sp|A9JR78|TONSL_DANRE Tonsoku-like protein OS=Danio rerio GN=tonsl PE=2 SV=1 244 347 4.0E-06
sp|Q5UQY4|YR886_MIMIV Putative ankyrin repeat protein R886 (Fragment) OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R886 PE=4 SV=1 91 204 4.0E-06
sp|Q8N7Z5|ANR31_HUMAN Putative ankyrin repeat domain-containing protein 31 OS=Homo sapiens GN=ANKRD31 PE=5 SV=2 357 450 4.0E-06
sp|Q8N7Z5|ANR31_HUMAN Putative ankyrin repeat domain-containing protein 31 OS=Homo sapiens GN=ANKRD31 PE=5 SV=2 178 301 4.0E-06
sp|Q8N7Z5|ANR31_HUMAN Putative ankyrin repeat domain-containing protein 31 OS=Homo sapiens GN=ANKRD31 PE=5 SV=2 133 235 4.0E-06
sp|Q00653|NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens GN=NFKB2 PE=1 SV=4 83 281 4.0E-06
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 380 535 5.0E-06
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 83 212 5.0E-06
sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 51 231 5.0E-06
sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 50 233 5.0E-06
sp|Q0P5G1|TONSL_BOVIN Tonsoku-like protein OS=Bos taurus GN=TONSL PE=2 SV=1 145 248 5.0E-06
sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 284 383 5.0E-06
sp|Q6NXT1|ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 284 383 5.0E-06
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 376 498 6.0E-06
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 325 529 6.0E-06
sp|Q07DX6|ASZ1_NOMLE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 51 197 6.0E-06
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 287 484 6.0E-06
sp|Q07DV3|ASZ1_AOTNA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 51 197 6.0E-06
sp|Q09YH1|ASZ1_SAIBB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 51 197 6.0E-06
sp|Q2QLG0|ASZ1_CALJA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 51 197 6.0E-06
sp|Q9QW30|NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 50 233 6.0E-06
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 339 447 6.0E-06
sp|Q6ZVZ8|ASB18_HUMAN Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens GN=ASB18 PE=2 SV=2 115 347 6.0E-06
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 380 498 6.0E-06
sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 284 383 6.0E-06
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 190 302 6.0E-06
sp|A1ZBY1|FEM1B_DROME Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 85 239 7.0E-06
sp|Q8VHK1|CSKI2_MOUSE Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 343 496 7.0E-06
sp|Q8VHK1|CSKI2_MOUSE Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 334 496 7.0E-06
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 329 491 7.0E-06
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 190 302 7.0E-06
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 383 535 8.0E-06
sp|Q108U1|ASZ1_LOXAF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 51 197 8.0E-06
sp|Q3UMT1|PP12C_MOUSE Protein phosphatase 1 regulatory subunit 12C OS=Mus musculus GN=Ppp1r12c PE=1 SV=1 338 500 8.0E-06
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 256 450 8.0E-06
sp|D4A615|TONSL_RAT Tonsoku-like protein OS=Rattus norvegicus GN=Tonsl PE=3 SV=1 277 381 8.0E-06
sp|Q8WXK4|ASB12_HUMAN Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 83 255 8.0E-06
sp|Q6NZL6|TONSL_MOUSE Tonsoku-like protein OS=Mus musculus GN=Tonsl PE=1 SV=2 277 381 8.0E-06
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 339 447 8.0E-06
sp|Q8N2N9|AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 147 332 8.0E-06
sp|Q876A6|AKR1_NAUCC Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 323 496 8.0E-06
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 391 498 9.0E-06
sp|Q9BZL4|PP12C_HUMAN Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens GN=PPP1R12C PE=1 SV=1 338 514 9.0E-06
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 86 288 9.0E-06
sp|O60733|PLPL9_HUMAN 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 277 501 9.0E-06
sp|Q5UQF2|YL482_MIMIV Putative ankyrin repeat protein L482 (Fragment) OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L482 PE=4 SV=1 117 231 9.0E-06
sp|P31695|NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 362 480 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5955
MSLLPLANELLVAIAQRLDSEKDINALARTNRRLYQLLIAHLYRHNARWSGSSALYWAARVGRGETLQRAVTVGA
KLHEHGLLSLAAEYGQEGIVHLLLAVDGIDLNVKHGSQWTPLAVASRKGHLGVARMLVKAGADLRVGYDGWTPLN
VAANSGHVEIVRFLCDSGSSVGEPSDTGWTPLKSAACNGHREVVELLLGRGANVHAAAERDWTPLHSAASFGHAA
IVGLLVDHGAKMGVATLDGWTPLTLAADKGRVEAVKMLIKMGADISQACGNGWTPLTLASDSGHVDVVQLLLSSG
ANVKSTCNNGWTSLSLASGASHLAVAKLLLNHGADVAATNDAGWSALLIASDRGHHDLVALLLERGADVTTANRN
GWTALHAAAENGDDDVAKLLLAAGADPMAGNRSGWSPLHVAAHNNHFLIVDLILRMPGLDVSHKDNNGRTAMFHA
AMRGNVDVVEQFLSRSIALDVPDAYGTTALTAAVRNGHDAVVRQLLGYDTPRSPIHPALEDGLGRSIVWWAERSG
STDMPALVREYVQAAPGSPLGGEIFDFQPGPVFFVEDSCWCEVCTRCTVLGTTSFECPICDGGCFLICAECHESG
FRCRSDAHQLVPHQCNRVE*
Coding >Hirsu2|5955
ATGTCGCTGCTGCCCCTTGCCAACGAGCTGCTTGTGGCCATCGCCCAGCGCCTCGACTCTGAAAAAGACATCAAT
GCTCTGGCCAGGACCAACCGCCGGCTGTATCAGCTGCTGATTGCCCACCTCTATCGTCACAACGCCCGCTGGTCC
GGGAGCTCGGCGCTGTACTGGGCCGCGAGAGTTGGGCGCGGCGAAACGCTACAACGGGCAGTAACCGTTGGGGCC
AAGCTTCACGAACATGGCCTCCTTTCGCTCGCGGCAGAATACGGGCAGGAGGGCATCGTTCATCTTCTGCTCGCA
GTCGACGGGATCGATCTGAACGTCAAGCACGGGAGCCAATGGACCCCGCTGGCCGTTGCTTCGCGAAAGGGTCAT
CTTGGGGTGGCCAGGATGCTCGTCAAGGCTGGTGCCGATCTGCGGGTAGGCTATGATGGCTGGACGCCCCTCAAC
GTGGCCGCCAATTCGGGACATGTTGAGATAGTGAGGTTTCTCTGCGACAGCGGGTCCAGCGTCGGAGAGCCGAGC
GACACTGGCTGGACACCATTGAAGTCGGCGGCTTGTAACGGACACAGAGAAGTGGTTGAGCTGCTCCTGGGTCGT
GGCGCCAACGTTCACGCCGCCGCCGAACGCGACTGGACACCTCTTCACTCCGCCGCCAGCTTCGGCCATGCGGCA
ATCGTCGGCCTGCTCGTCGACCACGGAGCCAAGATGGGCGTCGCCACACTGGACGGGTGGACACCCCTGACACTG
GCTGCGGACAAGGGAAGGGTAGAGGCAGTGAAGATGCTGATAAAGATGGGGGCCGATATATCTCAAGCCTGCGGC
AACGGCTGGACGCCCTTGACGCTGGCTTCGGACAGCGGCCACGTGGACGTCGTCCAGTTACTGCTTTCGTCCGGA
GCCAATGTCAAGTCGACCTGCAACAATGGCTGGACCTCGCTCAGCCTGGCTTCAGGGGCCTCCCATTTAGCAGTC
GCTAAGCTTCTCTTGAACCACGGAGCCGATGTCGCTGCGACAAACGATGCCGGCTGGTCCGCCCTTCTCATAGCC
TCGGACAGGGGCCATCACGATCTAGTGGCGCTACTGCTGGAGCGTGGCGCTGACGTCACGACTGCAAACCGCAAC
GGATGGACGGCTCTTCACGCAGCAGCAGAGAACGGAGATGACGATGTCGCCAAGTTGCTTCTTGCAGCTGGAGCG
GATCCTATGGCCGGCAACAGAAGCGGCTGGAGCCCACTGCATGTAGCTGCCCACAACAACCACTTCCTCATCGTC
GACCTCATACTCCGGATGCCCGGCCTGGATGTGAGCCACAAGGACAATAACGGCAGGACTGCAATGTTTCACGCC
GCGATGAGGGGAAACGTTGACGTCGTGGAGCAGTTCCTCTCCCGGAGCATCGCCTTGGATGTGCCGGATGCATAC
GGGACGACCGCCCTGACTGCGGCGGTCAGGAACGGACACGACGCCGTCGTTCGACAGTTGCTTGGATACGACACC
CCGAGATCTCCCATACATCCCGCTCTCGAAGACGGACTCGGGCGATCCATCGTGTGGTGGGCCGAGAGAAGCGGC
AGCACCGACATGCCTGCCCTCGTTCGCGAATATGTCCAGGCTGCCCCGGGAAGTCCACTTGGAGGCGAGATTTTC
GACTTCCAGCCGGGTCCAGTCTTCTTCGTGGAAGACTCGTGCTGGTGCGAGGTCTGCACAAGGTGTACCGTGCTG
GGTACGACGTCTTTCGAATGCCCGATTTGCGACGGTGGCTGCTTTCTGATCTGCGCCGAGTGTCACGAGTCGGGG
TTCCGGTGTCGCAGTGATGCCCACCAGCTGGTGCCTCACCAATGCAACAGGGTAGAGTAG
Transcript >Hirsu2|5955
ATGTCGCTGCTGCCCCTTGCCAACGAGCTGCTTGTGGCCATCGCCCAGCGCCTCGACTCTGAAAAAGACATCAAT
GCTCTGGCCAGGACCAACCGCCGGCTGTATCAGCTGCTGATTGCCCACCTCTATCGTCACAACGCCCGCTGGTCC
GGGAGCTCGGCGCTGTACTGGGCCGCGAGAGTTGGGCGCGGCGAAACGCTACAACGGGCAGTAACCGTTGGGGCC
AAGCTTCACGAACATGGCCTCCTTTCGCTCGCGGCAGAATACGGGCAGGAGGGCATCGTTCATCTTCTGCTCGCA
GTCGACGGGATCGATCTGAACGTCAAGCACGGGAGCCAATGGACCCCGCTGGCCGTTGCTTCGCGAAAGGGTCAT
CTTGGGGTGGCCAGGATGCTCGTCAAGGCTGGTGCCGATCTGCGGGTAGGCTATGATGGCTGGACGCCCCTCAAC
GTGGCCGCCAATTCGGGACATGTTGAGATAGTGAGGTTTCTCTGCGACAGCGGGTCCAGCGTCGGAGAGCCGAGC
GACACTGGCTGGACACCATTGAAGTCGGCGGCTTGTAACGGACACAGAGAAGTGGTTGAGCTGCTCCTGGGTCGT
GGCGCCAACGTTCACGCCGCCGCCGAACGCGACTGGACACCTCTTCACTCCGCCGCCAGCTTCGGCCATGCGGCA
ATCGTCGGCCTGCTCGTCGACCACGGAGCCAAGATGGGCGTCGCCACACTGGACGGGTGGACACCCCTGACACTG
GCTGCGGACAAGGGAAGGGTAGAGGCAGTGAAGATGCTGATAAAGATGGGGGCCGATATATCTCAAGCCTGCGGC
AACGGCTGGACGCCCTTGACGCTGGCTTCGGACAGCGGCCACGTGGACGTCGTCCAGTTACTGCTTTCGTCCGGA
GCCAATGTCAAGTCGACCTGCAACAATGGCTGGACCTCGCTCAGCCTGGCTTCAGGGGCCTCCCATTTAGCAGTC
GCTAAGCTTCTCTTGAACCACGGAGCCGATGTCGCTGCGACAAACGATGCCGGCTGGTCCGCCCTTCTCATAGCC
TCGGACAGGGGCCATCACGATCTAGTGGCGCTACTGCTGGAGCGTGGCGCTGACGTCACGACTGCAAACCGCAAC
GGATGGACGGCTCTTCACGCAGCAGCAGAGAACGGAGATGACGATGTCGCCAAGTTGCTTCTTGCAGCTGGAGCG
GATCCTATGGCCGGCAACAGAAGCGGCTGGAGCCCACTGCATGTAGCTGCCCACAACAACCACTTCCTCATCGTC
GACCTCATACTCCGGATGCCCGGCCTGGATGTGAGCCACAAGGACAATAACGGCAGGACTGCAATGTTTCACGCC
GCGATGAGGGGAAACGTTGACGTCGTGGAGCAGTTCCTCTCCCGGAGCATCGCCTTGGATGTGCCGGATGCATAC
GGGACGACCGCCCTGACTGCGGCGGTCAGGAACGGACACGACGCCGTCGTTCGACAGTTGCTTGGATACGACACC
CCGAGATCTCCCATACATCCCGCTCTCGAAGACGGACTCGGGCGATCCATCGTGTGGTGGGCCGAGAGAAGCGGC
AGCACCGACATGCCTGCCCTCGTTCGCGAATATGTCCAGGCTGCCCCGGGAAGTCCACTTGGAGGCGAGATTTTC
GACTTCCAGCCGGGTCCAGTCTTCTTCGTGGAAGACTCGTGCTGGTGCGAGGTCTGCACAAGGTGTACCGTGCTG
GGTACGACGTCTTTCGAATGCCCGATTTGCGACGGTGGCTGCTTTCTGATCTGCGCCGAGTGTCACGAGTCGGGG
TTCCGGTGTCGCAGTGATGCCCACCAGCTGGTGCCTCACCAATGCAACAGGGTAGAGTAG
Gene >Hirsu2|5955
ATGTCGCTGCTGCCCCTTGCCAACGAGCTGCTTGTGGCCATCGCCCAGCGCCTCGACTCTGAAAAAGACATCAAT
GCTCTGGCCAGGACCAACCGCCGGCTGTATCAGCTGCTGATTGCCCACCTCTATCGTCACAACGCCCGCTGGTCC
GGGAGCTCGGCGCTGTACTGGGCCGCGAGAGTTGGGCGCGGCGAAACGCTACAACGGGCAGTAACCGTTGGGGCC
AAGCTTCACGAACATGGCCTCCTTTCGCTCGCGGCAGAATACGGGCAGGAGGGCATCGTTCATCTTCTGCTCGCA
GTCGACGGGATCGATCTGAACGTCAAGCACGGGAGCCAATGGACCCCGCTGGCCGTTGCTTCGCGAAAGGGTCAT
CTTGGGGTGGCCAGGATGCTCGTCAAGGCTGGTGCCGATCTGCGGGTAGGCTATGATGGCTGGACGCCCCTCAAC
GTGGCCGCCAATTCGGGACATGTTGAGATAGTGAGGTTTCTCTGCGACAGCGGGTCCAGCGTCGGAGAGCCGAGC
GACACTGGCTGGACACCATTGAAGTCGGCGGCTTGTAACGGACACAGAGAAGTGGTTGAGCTGCTCCTGGGTCGT
GGCGCCAACGTTCACGCCGCCGCCGAACGCGACTGGACACCTCTTCACTCCGCCGCCAGCTTCGGCCATGCGGCA
ATCGTCGGCCTGCTCGTCGACCACGGAGCCAAGATGGGCGTCGCCACACTGGACGGGTGGACACCCCTGACACTG
GCTGCGGACAAGGGAAGGGTAGAGGCAGTGAAGATGCTGATAAAGATGGGGGCCGATATATCTCAAGCCTGCGGC
AACGGCTGGACGCCCTTGACGCTGGCTTCGGACAGCGGCCACGTGGACGTCGTCCAGTTACTGCTTTCGTCCGGA
GCCAATGTCAAGTCGACCTGCAACAATGGCTGGACCTCGCTCAGCCTGGCTTCAGGGGCCTCCCATTTAGCAGTC
GCTAAGCTTCTCTTGAACCACGGAGCCGATGTCGCTGCGACAAACGATGCCGGCTGGTCCGCCCTTCTCATAGCC
TCGGACAGGGGCCATCACGATCTAGTGGCGCTACTGCTGGAGCGTGGCGCTGACGTCACGACTGCAAACCGCAAC
GGATGGACGGCTCTTCACGCAGCAGCAGAGAACGGAGATGACGATGTCGCCAAGTTGCTTCTTGCAGCTGGAGCG
GATCCTATGGCCGGCAACAGAAGCGGCTGGAGCCCACTGCATGTAGCTGCCCACAACAACCACTTCCTCATCGTC
GACCTCATACTCCGGATGCCCGGCCTGGATGTGAGCCACAAGGACAATAACGGCAGGACTGCAATGTTTCACGCC
GCGATGAGGGGAAACGTTGACGTCGTGGAGCAGTTCCTCTCCCGGAGCATCGCCTTGGATGTGCCGGATGCATAC
GGGACGACCGCCCTGACTGCGGCGGTCAGGAACGGACACGACGCCGTCGTTCGACAGTTGCTTGGATACGACACC
CCGAGATCTCCCATACATCCCGCTCTCGAAGACGGACTCGGGCGATCCATCGTGTGGTGGGCCGAGAGAAGCGGC
AGCACCGACATGCCTGCCCTCGTTCGCGAATATGTCCAGGCTGCCCCGGGAAGTCCACTTGGAGGCGAGATTTTC
GACTTCCAGCCGGGTCCAGTCTTCTTCGTGGAAGACTCGTGCTGGTGCGAGGTCTGCACAAGGTGTACCGTGCTG
GGTACGACGTCTTTCGAATGCCCGATTTGCGACGGTGGCTGCTTTCTGATCTGCGCCGAGTGTCACGAGTCGGGG
TTCCGGTGTCGCAGTGATGCCCACCAGCTGGTGCCTCACCAATGCAACAGGGTAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail