Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5952
Gene name
LocationContig_30:24362..25580
Strand-
Gene length (bp)1218
Transcript length (bp)1218
Coding sequence length (bp)1218
Protein length (aa) 406

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06500 DUF1100 Alpha/beta hydrolase of unknown function (DUF1100) 8.8E-12 51 257
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 2.8E-08 175 384
PF00326 Peptidase_S9 Prolyl oligopeptidase family 1.6E-07 215 264
PF05448 AXE1 Acetyl xylan esterase (AXE1) 2.1E-05 200 268

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q93NG6|DHPON_ARTNI 2,6-dihydropseudooxynicotine hydrolase OS=Arthrobacter nicotinovorans PE=1 SV=1 48 264 3.0E-13
sp|Q6LTX5|Y837_PHOPR UPF0255 protein PBPRA0837 OS=Photobacterium profundum GN=PBPRA0837 PE=3 SV=1 30 249 8.0E-13
sp|Q7N7B3|Y1242_PHOLL UPF0255 protein plu1242 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=plu1242 PE=3 SV=1 50 279 6.0E-09
sp|B2K659|Y944_YERPB UPF0255 protein YPTS_0944 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=YPTS_0944 PE=3 SV=1 30 255 1.0E-07
sp|Q66DZ1|Y902_YERPS UPF0255 protein YPTB0902 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=YPTB0902 PE=3 SV=1 30 255 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q93NG6|DHPON_ARTNI 2,6-dihydropseudooxynicotine hydrolase OS=Arthrobacter nicotinovorans PE=1 SV=1 48 264 3.0E-13
sp|Q6LTX5|Y837_PHOPR UPF0255 protein PBPRA0837 OS=Photobacterium profundum GN=PBPRA0837 PE=3 SV=1 30 249 8.0E-13
sp|Q7N7B3|Y1242_PHOLL UPF0255 protein plu1242 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=plu1242 PE=3 SV=1 50 279 6.0E-09
sp|B2K659|Y944_YERPB UPF0255 protein YPTS_0944 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=YPTS_0944 PE=3 SV=1 30 255 1.0E-07
sp|Q66DZ1|Y902_YERPS UPF0255 protein YPTB0902 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=YPTB0902 PE=3 SV=1 30 255 1.0E-07
sp|Q1CLC9|Y869_YERPN UPF0255 protein YPN_0869 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=YPN_0869 PE=3 SV=1 30 255 1.0E-07
sp|A9R2X3|Y3303_YERPG UPF0255 protein YpAngola_A3303 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=YpAngola_A3303 PE=3 SV=1 30 255 1.0E-07
sp|B1JIH5|Y3290_YERPY UPF0255 protein YPK_3290 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=YPK_3290 PE=3 SV=1 30 255 1.0E-07
sp|Q8D170|Y3224_YERPE UPF0255 protein YPO3224/y0964/YP_0709 OS=Yersinia pestis GN=YPO3224 PE=3 SV=2 30 255 1.0E-07
sp|A7FLI4|Y3152_YERP3 UPF0255 protein YpsIP31758_3152 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=YpsIP31758_3152 PE=3 SV=1 30 255 1.0E-07
sp|A4TPK3|Y2853_YERPP UPF0255 protein YPDSF_2853 OS=Yersinia pestis (strain Pestoides F) GN=YPDSF_2853 PE=3 SV=1 30 255 1.0E-07
sp|Q1C4E4|Y2716_YERPA UPF0255 protein YPA_2716 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=YPA_2716 PE=3 SV=1 30 255 1.0E-07
sp|A8GAD1|Y965_SERP5 UPF0255 protein Spro_0965 OS=Serratia proteamaculans (strain 568) GN=Spro_0965 PE=3 SV=1 30 249 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0008152 metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0017171 serine hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5952
MALLLRHFFPRNPSFGYESLRAAGYANCGGADVAEVIAICSRIGSGDEVGWLREWRCAGDRAVANANTSLAKGNR
PGARDAFLRASNYYRTAEFYRRENPFDDDVSKELASLSAKMFYSAADLMPHATERISIPYEGVTLPGTLIRPDRS
EKPRPTIVVNGGFDSTREELGYAVAAAALELEFNVLAFDGPGQGDALREQRLYFRPDWEKVMTPVVDYALSQPWV
DKERLVIMGVSMGGYLVARAAAFEHRAAAVVVNDGVYDFGSAFRKENPAIGKFLIKHGWDGVMNALIRLYMRWDT
GFKWGVLNGKWVFGVSSEAEVLRLVEEYTLEGAVHQIKTPMLVLDAPDDHFLKGQPKELFDRLSCEKEFVELSRE
EGASAHCHMGSGARLNQVVFDYLLQRLNTS*
Coding >Hirsu2|5952
ATGGCACTGTTGCTGCGACACTTCTTTCCCCGAAACCCATCATTTGGCTACGAAAGCCTCCGTGCAGCCGGCTAT
GCCAACTGCGGTGGTGCAGATGTGGCAGAGGTGATTGCCATTTGTTCCCGCATCGGGTCCGGTGACGAAGTCGGC
TGGCTACGCGAATGGAGGTGCGCTGGCGACCGCGCTGTCGCCAATGCGAACACGAGCCTGGCCAAGGGGAACCGA
CCTGGCGCCCGGGACGCCTTCCTACGAGCCTCTAACTACTATCGTACTGCCGAGTTCTACCGGCGCGAGAATCCT
TTCGACGATGACGTATCTAAAGAGCTGGCAAGCCTGAGCGCCAAGATGTTCTACTCCGCGGCGGACCTTATGCCG
CACGCTACCGAGCGAATCAGCATACCCTACGAAGGGGTGACTCTGCCAGGCACACTCATACGCCCAGATAGGAGC
GAAAAGCCAAGACCAACTATCGTTGTTAACGGCGGCTTCGACTCGACGAGGGAGGAACTGGGCTACGCAGTTGCA
GCAGCCGCTCTCGAACTCGAGTTTAATGTCCTCGCCTTCGACGGGCCTGGGCAGGGCGACGCTTTACGGGAGCAG
CGGCTTTACTTCAGGCCAGACTGGGAGAAGGTCATGACGCCGGTGGTGGACTATGCCCTCTCTCAACCTTGGGTC
GATAAAGAGAGGCTTGTCATCATGGGCGTCAGCATGGGCGGCTATCTTGTAGCACGAGCTGCGGCATTCGAACAT
CGCGCCGCCGCCGTCGTTGTCAACGACGGCGTGTACGACTTTGGCAGTGCATTTCGCAAGGAGAACCCTGCTATC
GGGAAGTTCCTGATAAAGCACGGGTGGGATGGCGTCATGAATGCGCTCATCCGTCTGTATATGCGCTGGGACACT
GGCTTCAAATGGGGCGTCTTAAACGGTAAGTGGGTGTTCGGCGTTTCCTCCGAAGCCGAAGTTCTGCGACTCGTA
GAGGAATACACGCTCGAGGGGGCGGTGCATCAAATAAAGACGCCGATGCTGGTGCTGGATGCTCCGGACGATCAT
TTCTTGAAGGGACAGCCGAAGGAATTGTTTGACCGGCTATCGTGCGAGAAGGAATTCGTGGAACTTAGCAGAGAG
GAGGGGGCAAGTGCCCATTGCCACATGGGGTCCGGGGCAAGGCTTAACCAGGTAGTCTTCGACTACTTGCTGCAG
CGGCTGAATACGTCGTAG
Transcript >Hirsu2|5952
ATGGCACTGTTGCTGCGACACTTCTTTCCCCGAAACCCATCATTTGGCTACGAAAGCCTCCGTGCAGCCGGCTAT
GCCAACTGCGGTGGTGCAGATGTGGCAGAGGTGATTGCCATTTGTTCCCGCATCGGGTCCGGTGACGAAGTCGGC
TGGCTACGCGAATGGAGGTGCGCTGGCGACCGCGCTGTCGCCAATGCGAACACGAGCCTGGCCAAGGGGAACCGA
CCTGGCGCCCGGGACGCCTTCCTACGAGCCTCTAACTACTATCGTACTGCCGAGTTCTACCGGCGCGAGAATCCT
TTCGACGATGACGTATCTAAAGAGCTGGCAAGCCTGAGCGCCAAGATGTTCTACTCCGCGGCGGACCTTATGCCG
CACGCTACCGAGCGAATCAGCATACCCTACGAAGGGGTGACTCTGCCAGGCACACTCATACGCCCAGATAGGAGC
GAAAAGCCAAGACCAACTATCGTTGTTAACGGCGGCTTCGACTCGACGAGGGAGGAACTGGGCTACGCAGTTGCA
GCAGCCGCTCTCGAACTCGAGTTTAATGTCCTCGCCTTCGACGGGCCTGGGCAGGGCGACGCTTTACGGGAGCAG
CGGCTTTACTTCAGGCCAGACTGGGAGAAGGTCATGACGCCGGTGGTGGACTATGCCCTCTCTCAACCTTGGGTC
GATAAAGAGAGGCTTGTCATCATGGGCGTCAGCATGGGCGGCTATCTTGTAGCACGAGCTGCGGCATTCGAACAT
CGCGCCGCCGCCGTCGTTGTCAACGACGGCGTGTACGACTTTGGCAGTGCATTTCGCAAGGAGAACCCTGCTATC
GGGAAGTTCCTGATAAAGCACGGGTGGGATGGCGTCATGAATGCGCTCATCCGTCTGTATATGCGCTGGGACACT
GGCTTCAAATGGGGCGTCTTAAACGGTAAGTGGGTGTTCGGCGTTTCCTCCGAAGCCGAAGTTCTGCGACTCGTA
GAGGAATACACGCTCGAGGGGGCGGTGCATCAAATAAAGACGCCGATGCTGGTGCTGGATGCTCCGGACGATCAT
TTCTTGAAGGGACAGCCGAAGGAATTGTTTGACCGGCTATCGTGCGAGAAGGAATTCGTGGAACTTAGCAGAGAG
GAGGGGGCAAGTGCCCATTGCCACATGGGGTCCGGGGCAAGGCTTAACCAGGTAGTCTTCGACTACTTGCTGCAG
CGGCTGAATACGTCGTAG
Gene >Hirsu2|5952
ATGGCACTGTTGCTGCGACACTTCTTTCCCCGAAACCCATCATTTGGCTACGAAAGCCTCCGTGCAGCCGGCTAT
GCCAACTGCGGTGGTGCAGATGTGGCAGAGGTGATTGCCATTTGTTCCCGCATCGGGTCCGGTGACGAAGTCGGC
TGGCTACGCGAATGGAGGTGCGCTGGCGACCGCGCTGTCGCCAATGCGAACACGAGCCTGGCCAAGGGGAACCGA
CCTGGCGCCCGGGACGCCTTCCTACGAGCCTCTAACTACTATCGTACTGCCGAGTTCTACCGGCGCGAGAATCCT
TTCGACGATGACGTATCTAAAGAGCTGGCAAGCCTGAGCGCCAAGATGTTCTACTCCGCGGCGGACCTTATGCCG
CACGCTACCGAGCGAATCAGCATACCCTACGAAGGGGTGACTCTGCCAGGCACACTCATACGCCCAGATAGGAGC
GAAAAGCCAAGACCAACTATCGTTGTTAACGGCGGCTTCGACTCGACGAGGGAGGAACTGGGCTACGCAGTTGCA
GCAGCCGCTCTCGAACTCGAGTTTAATGTCCTCGCCTTCGACGGGCCTGGGCAGGGCGACGCTTTACGGGAGCAG
CGGCTTTACTTCAGGCCAGACTGGGAGAAGGTCATGACGCCGGTGGTGGACTATGCCCTCTCTCAACCTTGGGTC
GATAAAGAGAGGCTTGTCATCATGGGCGTCAGCATGGGCGGCTATCTTGTAGCACGAGCTGCGGCATTCGAACAT
CGCGCCGCCGCCGTCGTTGTCAACGACGGCGTGTACGACTTTGGCAGTGCATTTCGCAAGGAGAACCCTGCTATC
GGGAAGTTCCTGATAAAGCACGGGTGGGATGGCGTCATGAATGCGCTCATCCGTCTGTATATGCGCTGGGACACT
GGCTTCAAATGGGGCGTCTTAAACGGTAAGTGGGTGTTCGGCGTTTCCTCCGAAGCCGAAGTTCTGCGACTCGTA
GAGGAATACACGCTCGAGGGGGCGGTGCATCAAATAAAGACGCCGATGCTGGTGCTGGATGCTCCGGACGATCAT
TTCTTGAAGGGACAGCCGAAGGAATTGTTTGACCGGCTATCGTGCGAGAAGGAATTCGTGGAACTTAGCAGAGAG
GAGGGGGCAAGTGCCCATTGCCACATGGGGTCCGGGGCAAGGCTTAACCAGGTAGTCTTCGACTACTTGCTGCAG
CGGCTGAATACGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail