Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5947
Gene name
LocationContig_30:12877..14306
Strand+
Gene length (bp)1429
Transcript length (bp)1341
Coding sequence length (bp)1341
Protein length (aa) 447

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q91090|PON2_MELGA Serum paraoxonase/arylesterase 2 OS=Meleagris gallopavo GN=PON2 PE=2 SV=1 110 265 1.0E-12
sp|Q90952|PON2_CHICK Serum paraoxonase/arylesterase 2 OS=Gallus gallus GN=PON2 PE=2 SV=1 110 265 1.0E-12
sp|Q58DS7|PON2_BOVIN Serum paraoxonase/arylesterase 2 OS=Bos taurus GN=PON2 PE=2 SV=1 111 265 6.0E-12
sp|Q9BGN0|PON3_RABIT Serum paraoxonase/lactonase 3 OS=Oryctolagus cuniculus GN=PON3 PE=1 SV=1 47 333 1.0E-11
sp|P52430|PON1_MOUSE Serum paraoxonase/arylesterase 1 OS=Mus musculus GN=Pon1 PE=1 SV=2 129 333 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q91090|PON2_MELGA Serum paraoxonase/arylesterase 2 OS=Meleagris gallopavo GN=PON2 PE=2 SV=1 110 265 1.0E-12
sp|Q90952|PON2_CHICK Serum paraoxonase/arylesterase 2 OS=Gallus gallus GN=PON2 PE=2 SV=1 110 265 1.0E-12
sp|Q58DS7|PON2_BOVIN Serum paraoxonase/arylesterase 2 OS=Bos taurus GN=PON2 PE=2 SV=1 111 265 6.0E-12
sp|Q9BGN0|PON3_RABIT Serum paraoxonase/lactonase 3 OS=Oryctolagus cuniculus GN=PON3 PE=1 SV=1 47 333 1.0E-11
sp|P52430|PON1_MOUSE Serum paraoxonase/arylesterase 1 OS=Mus musculus GN=Pon1 PE=1 SV=2 129 333 2.0E-11
sp|P54832|PON2_CANLF Serum paraoxonase/arylesterase 2 OS=Canis lupus familiaris GN=PON2 PE=2 SV=1 107 328 6.0E-11
sp|Q6AXM8|PON2_RAT Serum paraoxonase/arylesterase 2 OS=Rattus norvegicus GN=Pon2 PE=2 SV=1 69 243 6.0E-11
sp|Q15165|PON2_HUMAN Serum paraoxonase/arylesterase 2 OS=Homo sapiens GN=PON2 PE=1 SV=3 69 328 9.0E-11
sp|P55159|PON1_RAT Serum paraoxonase/arylesterase 1 OS=Rattus norvegicus GN=Pon1 PE=1 SV=3 129 333 1.0E-10
sp|P27170|PON1_RABIT Serum paraoxonase/arylesterase 1 OS=Oryctolagus cuniculus GN=PON1 PE=1 SV=2 69 239 1.0E-10
sp|Q62086|PON2_MOUSE Serum paraoxonase/arylesterase 2 OS=Mus musculus GN=Pon2 PE=1 SV=2 69 243 3.0E-10
sp|Q15166|PON3_HUMAN Serum paraoxonase/lactonase 3 OS=Homo sapiens GN=PON3 PE=1 SV=3 69 272 2.0E-09
sp|P27169|PON1_HUMAN Serum paraoxonase/arylesterase 1 OS=Homo sapiens GN=PON1 PE=1 SV=3 129 243 2.0E-09
sp|Q62087|PON3_MOUSE Serum paraoxonase/lactonase 3 OS=Mus musculus GN=Pon3 PE=1 SV=2 132 266 4.0E-08
sp|Q68FP2|PON3_RAT Serum paraoxonase/lactonase 3 OS=Rattus norvegicus GN=Pon3 PE=2 SV=1 132 326 9.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5947
MAARRSFYLAPLVLLSAVLISYYYGATLKRTSLVLGLFRIPAKHSLASPDDLVRIEGTAHCEDLHYHEPSGLLFT
ACEDAQTTRHLWFPPLGIFDDHLPTARDRGSLKIIDPKTLKARSLRFENFEKPFVTHGIDVFDDPRRNKGEAIYI
FAVNHVPNVEYYGKGRRDVSKSRSVVEIFHYTIGSDSVKHIRTVWHPLLTTPNDILALSPESFLVTNDHFYREGV
MRQIEDLHFGARWTDTVHVRFLPGDGTTAAKHDADGVEASVALGNMHNNNGIGRGKGPRDVLVTSASSGVLHLGT
RDGSSTGAPQTIKITETIELDSTIDNPSYFADPYANGTFDASGVVVCGLSRAVDILKNGRIPDAVDGIMVWMVSP
SGPGDTNPTEKWTKRLLFQDDGTAVRSCSAAVLVPNEPSAQDGRRQAQLFVTGFLSNNMASITLNLGDYGF*
Coding >Hirsu2|5947
ATGGCCGCTCGCCGCTCGTTCTATCTGGCCCCTCTTGTGCTGCTCTCCGCAGTCCTCATATCTTATTACTACGGC
GCCACCTTGAAACGGACGAGCCTGGTCCTGGGCCTCTTCCGGATTCCCGCAAAACACAGCCTGGCCTCGCCCGAC
GACCTTGTCCGCATCGAGGGTACCGCCCACTGCGAGGACCTCCACTACCACGAGCCGAGCGGCCTCTTGTTTACC
GCCTGCGAGGACGCCCAGACAACGCGGCATCTTTGGTTCCCGCCGCTCGGGATTTTCGATGATCACCTCCCAACC
GCCAGGGATCGCGGCAGCTTGAAGATCATTGACCCTAAGACCCTGAAAGCGCGATCGCTGCGATTCGAGAACTTC
GAAAAACCGTTCGTGACGCACGGAATCGACGTATTCGACGACCCTCGCAGGAACAAAGGCGAGGCCATCTATATC
TTCGCCGTCAATCACGTTCCCAACGTAGAATACTACGGAAAAGGCCGGCGAGATGTTTCGAAAAGCCGTTCAGTC
GTTGAGATCTTCCACTACACTATCGGCTCAGACTCCGTCAAACATATCCGCACCGTCTGGCACCCATTATTGACC
ACCCCGAACGACATTCTGGCCTTGTCGCCAGAGTCCTTCTTGGTAACCAACGACCACTTCTACAGAGAAGGGGTC
ATGAGACAAATTGAAGACCTCCACTTTGGCGCGCGGTGGACCGACACCGTACACGTTCGATTCCTTCCTGGCGAC
GGGACGACTGCTGCAAAACATGATGCTGACGGGGTCGAGGCGTCTGTCGCTCTTGGTAACATGCACAACAACAAC
GGCATCGGTCGCGGCAAGGGGCCACGGGACGTGCTGGTCACCAGCGCCTCCAGCGGTGTCCTGCACCTGGGCACC
CGCGACGGCAGCTCGACGGGCGCACCGCAGACGATCAAGATCACCGAGACGATCGAGCTGGACTCTACCATAGAC
AACCCGAGCTACTTTGCCGACCCCTATGCCAACGGCACATTTGACGCAAGTGGGGTTGTCGTCTGTGGCCTATCG
AGAGCTGTAGATATCCTCAAGAATGGCCGCATCCCGGATGCCGTGGACGGCATCATGGTCTGGATGGTTTCTCCT
TCAGGGCCGGGAGACACAAATCCGACGGAGAAATGGACAAAACGCCTGCTGTTCCAAGACGACGGGACAGCAGTC
CGCAGCTGCAGCGCAGCCGTCTTGGTGCCAAACGAGCCTTCCGCCCAAGACGGTCGCCGTCAAGCTCAACTGTTC
GTCACGGGATTCCTGAGCAACAATATGGCCTCCATAACACTGAACTTGGGAGATTATGGGTTTTAG
Transcript >Hirsu2|5947
ATGGCCGCTCGCCGCTCGTTCTATCTGGCCCCTCTTGTGCTGCTCTCCGCAGTCCTCATATCTTATTACTACGGC
GCCACCTTGAAACGGACGAGCCTGGTCCTGGGCCTCTTCCGGATTCCCGCAAAACACAGCCTGGCCTCGCCCGAC
GACCTTGTCCGCATCGAGGGTACCGCCCACTGCGAGGACCTCCACTACCACGAGCCGAGCGGCCTCTTGTTTACC
GCCTGCGAGGACGCCCAGACAACGCGGCATCTTTGGTTCCCGCCGCTCGGGATTTTCGATGATCACCTCCCAACC
GCCAGGGATCGCGGCAGCTTGAAGATCATTGACCCTAAGACCCTGAAAGCGCGATCGCTGCGATTCGAGAACTTC
GAAAAACCGTTCGTGACGCACGGAATCGACGTATTCGACGACCCTCGCAGGAACAAAGGCGAGGCCATCTATATC
TTCGCCGTCAATCACGTTCCCAACGTAGAATACTACGGAAAAGGCCGGCGAGATGTTTCGAAAAGCCGTTCAGTC
GTTGAGATCTTCCACTACACTATCGGCTCAGACTCCGTCAAACATATCCGCACCGTCTGGCACCCATTATTGACC
ACCCCGAACGACATTCTGGCCTTGTCGCCAGAGTCCTTCTTGGTAACCAACGACCACTTCTACAGAGAAGGGGTC
ATGAGACAAATTGAAGACCTCCACTTTGGCGCGCGGTGGACCGACACCGTACACGTTCGATTCCTTCCTGGCGAC
GGGACGACTGCTGCAAAACATGATGCTGACGGGGTCGAGGCGTCTGTCGCTCTTGGTAACATGCACAACAACAAC
GGCATCGGTCGCGGCAAGGGGCCACGGGACGTGCTGGTCACCAGCGCCTCCAGCGGTGTCCTGCACCTGGGCACC
CGCGACGGCAGCTCGACGGGCGCACCGCAGACGATCAAGATCACCGAGACGATCGAGCTGGACTCTACCATAGAC
AACCCGAGCTACTTTGCCGACCCCTATGCCAACGGCACATTTGACGCAAGTGGGGTTGTCGTCTGTGGCCTATCG
AGAGCTGTAGATATCCTCAAGAATGGCCGCATCCCGGATGCCGTGGACGGCATCATGGTCTGGATGGTTTCTCCT
TCAGGGCCGGGAGACACAAATCCGACGGAGAAATGGACAAAACGCCTGCTGTTCCAAGACGACGGGACAGCAGTC
CGCAGCTGCAGCGCAGCCGTCTTGGTGCCAAACGAGCCTTCCGCCCAAGACGGTCGCCGTCAAGCTCAACTGTTC
GTCACGGGATTCCTGAGCAACAATATGGCCTCCATAACACTGAACTTGGGAGATTATGGGTTTTAG
Gene >Hirsu2|5947
ATGGCCGCTCGCCGCTCGTTCTATCTGGCCCCTCTTGTGCTGCTCTCCGCAGTCCTCATATCTTATTACTACGGC
GCCACCTTGAAACGGACGAGCCTGGTCCTGGGCCTCTTCCGGATTCCCGCAAAACACAGCCTGGCCTCGCCCGAC
GACCTTGTCCGCATCGAGGGTACCGCCCACTGCGAGGACCTCCACTACCACGAGCCGAGCGGCCTCTTGTTTACC
GCCTGCGAGGACGCCCAGACAACGCGGCATCTTTGGTTCCCGCCGCTCGGGATTTTCGATGATCACCTCCCAACC
GCCAGGGATCGCGGCAGCTTGAAGATCATTGACCCTAAGGTGCGTTCAGGACTAGAGTCCCCCTTCGTTCACCAT
ACTGGCGAGCTCCGCCTTTGTGTCGGTAGTCGATTCTGACACGAGCTGTCAGACCCTGAAAGCGCGATCGCTGCG
ATTCGAGAACTTCGAAAAACCGTTCGTGACGCACGGAATCGACGTATTCGACGACCCTCGCAGGAACAAAGGCGA
GGCCATCTATATCTTCGCCGTCAATCACGTTCCCAACGTAGAATACTACGGAAAAGGCCGGCGAGATGTTTCGAA
AAGCCGTTCAGTCGTTGAGATCTTCCACTACACTATCGGCTCAGACTCCGTCAAACATATCCGCACCGTCTGGCA
CCCATTATTGACCACCCCGAACGACATTCTGGCCTTGTCGCCAGAGTCCTTCTTGGTAACCAACGACCACTTCTA
CAGAGAAGGGGTCATGAGACAAATTGAAGACCTCCACTTTGGCGCGCGGTGGACCGACACCGTACACGTTCGATT
CCTTCCTGGCGACGGGACGACTGCTGCAAAACATGATGCTGACGGGGTCGAGGCGTCTGTCGCTCTTGGTAACAT
GCACAACAACAACGGCATCGGTCGCGGCAAGGGGCCACGGGACGTGCTGGTCACCAGCGCCTCCAGCGGTGTCCT
GCACCTGGGCACCCGCGACGGCAGCTCGACGGGCGCACCGCAGACGATCAAGATCACCGAGACGATCGAGCTGGA
CTCTACCATAGACAACCCGAGCTACTTTGCCGACCCCTATGCCAACGGCACATTTGACGCAAGTGGGGTTGTCGT
CTGTGGCCTATCGAGAGCTGTAGATATCCTCAAGAATGGCCGCATCCCGGATGCCGTGGACGGCATCATGGTCTG
GATGGTTTCTCCTTCAGGGCCGGGAGACACAAATCCGACGGAGAAATGGACAAAACGCCTGCTGTTCCAAGACGA
CGGGACAGCAGTCCGCAGCTGCAGCGCAGCCGTCTTGGTGCCAAACGAGCCTTCCGCCCAAGACGGTCGCCGTCA
AGCTCAACTGTTCGTCACGGGATTCCTGAGCAACAATATGGCCTCCATAACACTGAACTTGGGAGATTATGGGTT
TTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail