Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5939
Gene name
LocationContig_3:94948..97147
Strand+
Gene length (bp)2199
Transcript length (bp)2199
Coding sequence length (bp)2199
Protein length (aa) 733

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00620 RhoGAP RhoGAP domain 3.2E-39 467 617

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10164|RGA2_SCHPO Probable Rho-type GTPase-activating protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga2 PE=1 SV=1 445 632 2.0E-35
sp|P32873|BEM3_YEAST GTPase-activating protein BEM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BEM3 PE=1 SV=3 445 632 1.0E-31
sp|Q74ZH7|BEM3_ASHGO GTPase-activating protein BEM3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BEM3 PE=3 SV=2 445 632 1.0E-26
sp|Q55DW9|GACZ_DICDI Rho GTPase-activating protein gacZ OS=Dictyostelium discoideum GN=gacZ PE=3 SV=1 446 634 1.0E-20
sp|Q54TH9|GACY_DICDI Rho GTPase-activating protein gacY OS=Dictyostelium discoideum GN=gacY PE=3 SV=1 440 614 3.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10164|RGA2_SCHPO Probable Rho-type GTPase-activating protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga2 PE=1 SV=1 445 632 2.0E-35
sp|P32873|BEM3_YEAST GTPase-activating protein BEM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BEM3 PE=1 SV=3 445 632 1.0E-31
sp|Q74ZH7|BEM3_ASHGO GTPase-activating protein BEM3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BEM3 PE=3 SV=2 445 632 1.0E-26
sp|Q55DW9|GACZ_DICDI Rho GTPase-activating protein gacZ OS=Dictyostelium discoideum GN=gacZ PE=3 SV=1 446 634 1.0E-20
sp|Q54TH9|GACY_DICDI Rho GTPase-activating protein gacY OS=Dictyostelium discoideum GN=gacY PE=3 SV=1 440 614 3.0E-20
sp|Q15311|RBP1_HUMAN RalA-binding protein 1 OS=Homo sapiens GN=RALBP1 PE=1 SV=3 445 633 3.0E-20
sp|Q9PT60|RBP1A_XENLA RalA-binding protein 1-A OS=Xenopus laevis GN=ralbp1-a PE=1 SV=3 445 633 1.0E-19
sp|Q8C4V1|RHG24_MOUSE Rho GTPase-activating protein 24 OS=Mus musculus GN=Arhgap24 PE=1 SV=2 445 614 4.0E-19
sp|O94988|FA13A_HUMAN Protein FAM13A OS=Homo sapiens GN=FAM13A PE=1 SV=2 443 635 8.0E-19
sp|Q8N264|RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens GN=ARHGAP24 PE=1 SV=2 445 637 8.0E-19
sp|Q5U2Z7|RHG24_RAT Rho GTPase-activating protein 24 OS=Rattus norvegicus GN=Arhgap24 PE=1 SV=2 445 614 8.0E-19
sp|Q54C77|Y3184_DICDI Probable inactive serine/threonine-protein kinase DDB_G0293184 OS=Dictyostelium discoideum GN=DDB_G0293184 PE=3 SV=1 402 632 1.0E-18
sp|Q53QZ3|RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens GN=ARHGAP15 PE=1 SV=2 444 614 2.0E-18
sp|A4IF90|RHG15_BOVIN Rho GTPase-activating protein 15 OS=Bos taurus GN=ARHGAP15 PE=2 SV=1 444 614 3.0E-18
sp|Q62172|RBP1_MOUSE RalA-binding protein 1 OS=Mus musculus GN=Ralbp1 PE=1 SV=4 441 633 4.0E-18
sp|Q5ZMM3|RHG15_CHICK Rho GTPase-activating protein 15 OS=Gallus gallus GN=ARHGAP15 PE=2 SV=1 444 633 6.0E-18
sp|A6QNS3|ABR_BOVIN Active breakpoint cluster region-related protein OS=Bos taurus GN=ABR PE=2 SV=1 438 620 7.0E-18
sp|Q5SSL4|ABR_MOUSE Active breakpoint cluster region-related protein OS=Mus musculus GN=Abr PE=1 SV=1 438 620 8.0E-18
sp|O74360|RGA4_SCHPO Probable Rho-type GTPase-activating protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga4 PE=1 SV=2 462 635 8.0E-18
sp|Q7Z5H3|RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens GN=ARHGAP22 PE=1 SV=1 445 632 1.0E-17
sp|Q12979|ABR_HUMAN Active breakpoint cluster region-related protein OS=Homo sapiens GN=ABR PE=2 SV=2 429 620 1.0E-17
sp|Q811M1|RHG15_MOUSE Rho GTPase-activating protein 15 OS=Mus musculus GN=Arhgap15 PE=1 SV=1 444 614 1.0E-17
sp|Q8BL80|RHG22_MOUSE Rho GTPase-activating protein 22 OS=Mus musculus GN=Arhgap22 PE=1 SV=2 445 632 4.0E-17
sp|Q62796|RBP1_RAT RalA-binding protein 1 OS=Rattus norvegicus GN=Ralbp1 PE=1 SV=3 464 633 4.0E-17
sp|A4II46|ABR_XENTR Active breakpoint cluster region-related protein OS=Xenopus tropicalis GN=abr PE=2 SV=1 429 620 5.0E-17
sp|Q9VDG2|RLIP_DROME RalA-binding protein 1 OS=Drosophila melanogaster GN=Rlip PE=1 SV=1 445 651 7.0E-17
sp|Q8AVG0|ABR_XENLA Active breakpoint cluster region-related protein OS=Xenopus laevis GN=abr PE=2 SV=1 429 620 1.0E-16
sp|Q6AYC5|RHG15_RAT Rho GTPase-activating protein 15 OS=Rattus norvegicus GN=Arhgap15 PE=1 SV=1 444 614 2.0E-16
sp|P11274|BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens GN=BCR PE=1 SV=2 438 618 3.0E-16
sp|Q6PAJ1|BCR_MOUSE Breakpoint cluster region protein OS=Mus musculus GN=Bcr PE=1 SV=3 438 618 5.0E-16
sp|A2AB59|RHG27_MOUSE Rho GTPase-activating protein 27 OS=Mus musculus GN=Arhgap27 PE=1 SV=1 444 617 7.0E-16
sp|Q13017|RHG05_HUMAN Rho GTPase-activating protein 5 OS=Homo sapiens GN=ARHGAP5 PE=1 SV=2 446 632 9.0E-16
sp|Q6TLK4|RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus GN=Arhgap27 PE=1 SV=1 444 617 1.0E-15
sp|Q6ZUM4|RHG27_HUMAN Rho GTPase-activating protein 27 OS=Homo sapiens GN=ARHGAP27 PE=1 SV=3 444 617 1.0E-15
sp|Q9VTU3|RG68F_DROME Rho GTPase-activating protein 68F OS=Drosophila melanogaster GN=RhoGAP68F PE=1 SV=1 465 614 1.0E-15
sp|P97393|RHG05_MOUSE Rho GTPase-activating protein 5 OS=Mus musculus GN=Arhgap5 PE=1 SV=2 446 632 4.0E-15
sp|P81128|RHG35_RAT Rho GTPase-activating protein 35 OS=Rattus norvegicus GN=Arhgap35 PE=1 SV=2 466 632 7.0E-15
sp|P83509|RHG35_CANLF Rho GTPase-activating protein 35 OS=Canis lupus familiaris GN=ARHGAP35 PE=2 SV=1 466 632 1.0E-14
sp|Q68EM7|RHG17_HUMAN Rho GTPase-activating protein 17 OS=Homo sapiens GN=ARHGAP17 PE=1 SV=1 446 614 1.0E-14
sp|Q9NRY4|RHG35_HUMAN Rho GTPase-activating protein 35 OS=Homo sapiens GN=ARHGAP35 PE=1 SV=3 466 632 1.0E-14
sp|Q9Y3L3|3BP1_HUMAN SH3 domain-binding protein 1 OS=Homo sapiens GN=SH3BP1 PE=1 SV=3 444 617 2.0E-14
sp|Q86IG9|GACH_DICDI Rho GTPase-activating protein gacH OS=Dictyostelium discoideum GN=gacH PE=3 SV=1 466 632 2.0E-14
sp|Q91YM2|RHG35_MOUSE Rho GTPase-activating protein 35 OS=Mus musculus GN=Arhgap35 PE=1 SV=3 466 632 2.0E-14
sp|P98171|RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens GN=ARHGAP4 PE=1 SV=2 466 619 2.0E-14
sp|Q8BYW1|RHG25_MOUSE Rho GTPase-activating protein 25 OS=Mus musculus GN=Arhgap25 PE=1 SV=2 445 610 6.0E-14
sp|Q3UIA2|RHG17_MOUSE Rho GTPase-activating protein 17 OS=Mus musculus GN=Arhgap17 PE=1 SV=1 446 614 6.0E-14
sp|Q99N37|RHG17_RAT Rho GTPase-activating protein 17 OS=Rattus norvegicus GN=Arhgap17 PE=1 SV=1 446 614 6.0E-14
sp|Q9P107|GMIP_HUMAN GEM-interacting protein OS=Homo sapiens GN=GMIP PE=1 SV=2 466 677 7.0E-14
sp|Q9P227|RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens GN=ARHGAP23 PE=1 SV=2 439 614 7.0E-14
sp|P15882|CHIN_HUMAN N-chimaerin OS=Homo sapiens GN=CHN1 PE=1 SV=3 440 614 1.0E-13
sp|Q69ZH9|RHG23_MOUSE Rho GTPase-activating protein 23 OS=Mus musculus GN=Arhgap23 PE=1 SV=2 439 640 1.0E-13
sp|Q92619|HMHA1_HUMAN Minor histocompatibility protein HA-1 OS=Homo sapiens GN=HMHA1 PE=1 SV=2 444 620 1.0E-13
sp|Q86I31|GACFF_DICDI Rho GTPase-activating protein gacFF OS=Dictyostelium discoideum GN=gacFF PE=2 SV=1 445 632 2.0E-13
sp|P55194|3BP1_MOUSE SH3 domain-binding protein 1 OS=Mus musculus GN=Sh3bp1 PE=1 SV=2 463 617 2.0E-13
sp|O14559|RHG33_HUMAN Rho GTPase-activating protein 33 OS=Homo sapiens GN=ARHGAP33 PE=1 SV=2 443 614 2.0E-13
sp|Q80YF9|RHG33_MOUSE Rho GTPase-activating protein 33 OS=Mus musculus GN=Arhgap33 PE=1 SV=1 443 614 2.0E-13
sp|P42331|RHG25_HUMAN Rho GTPase-activating protein 25 OS=Homo sapiens GN=ARHGAP25 PE=1 SV=2 445 700 2.0E-13
sp|Q54FG5|GACJJ_DICDI Rho GTPase-activating protein gacJJ OS=Dictyostelium discoideum GN=gacJJ PE=3 SV=1 466 614 2.0E-13
sp|Q17QN0|CHIN_BOVIN N-chimaerin OS=Bos taurus GN=CHN1 PE=2 SV=1 467 614 3.0E-13
sp|Q5SSM3|RHG44_MOUSE Rho GTPase-activating protein 44 OS=Mus musculus GN=Arhgap44 PE=1 SV=1 463 617 3.0E-13
sp|Q17R89|RHG44_HUMAN Rho GTPase-activating protein 44 OS=Homo sapiens GN=ARHGAP44 PE=1 SV=1 446 617 3.0E-13
sp|Q8SSN9|GACF_DICDI Rho GTPase-activating protein gacF OS=Dictyostelium discoideum GN=gacF PE=3 SV=2 466 634 4.0E-13
sp|Q6REY9|RHG20_RAT Rho GTPase-activating protein 20 OS=Rattus norvegicus GN=Arhgap20 PE=1 SV=2 444 617 5.0E-13
sp|F1LQX4|RHG44_RAT Rho GTPase-activating protein 44 OS=Rattus norvegicus GN=Arhgap44 PE=1 SV=2 463 617 6.0E-13
sp|Q03070|CHIO_RAT Beta-chimaerin OS=Rattus norvegicus GN=Chn2 PE=2 SV=1 440 617 6.0E-13
sp|P30337|CHIN_RAT N-chimaerin OS=Rattus norvegicus GN=Chn1 PE=1 SV=2 467 614 7.0E-13
sp|Q8IWW6|RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens GN=ARHGAP12 PE=1 SV=1 444 617 7.0E-13
sp|Q6PGG2|GMIP_MOUSE GEM-interacting protein OS=Mus musculus GN=Gmip PE=1 SV=1 466 642 7.0E-13
sp|Q6IFT4|RHG20_MOUSE Rho GTPase-activating protein 20 OS=Mus musculus GN=Arhgap20 PE=1 SV=1 444 617 8.0E-13
sp|Q9H0H5|RGAP1_HUMAN Rac GTPase-activating protein 1 OS=Homo sapiens GN=RACGAP1 PE=1 SV=1 466 614 8.0E-13
sp|Q91V57|CHIN_MOUSE N-chimaerin OS=Mus musculus GN=Chn1 PE=1 SV=2 467 614 1.0E-12
sp|O14014|RGA3_SCHPO Probable Rho-type GTPase-activating protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga3 PE=1 SV=1 445 614 1.0E-12
sp|Q640N3|RHG30_MOUSE Rho GTPase-activating protein 30 OS=Mus musculus GN=Arhgap30 PE=1 SV=3 443 614 1.0E-12
sp|Q9P2F6|RHG20_HUMAN Rho GTPase-activating protein 20 OS=Homo sapiens GN=ARHGAP20 PE=1 SV=2 444 617 1.0E-12
sp|Q9BE31|RHG12_MACFA Rho GTPase-activating protein 12 OS=Macaca fascicularis GN=ARHGAP12 PE=2 SV=1 444 617 2.0E-12
sp|Q80XD1|CHIO_MOUSE Beta-chimaerin OS=Mus musculus GN=Chn2 PE=1 SV=2 467 617 2.0E-12
sp|P52757|CHIO_HUMAN Beta-chimaerin OS=Homo sapiens GN=CHN2 PE=1 SV=2 467 617 2.0E-12
sp|Q7Z6I6|RHG30_HUMAN Rho GTPase-activating protein 30 OS=Homo sapiens GN=ARHGAP30 PE=1 SV=3 441 614 2.0E-12
sp|Q8C0D4|RHG12_MOUSE Rho GTPase-activating protein 12 OS=Mus musculus GN=Arhgap12 PE=1 SV=2 444 617 2.0E-12
sp|Q5RB40|HMHA1_PONAB Minor histocompatibility protein HA-1 OS=Pongo abelii GN=HMHA1 PE=2 SV=1 444 620 2.0E-12
sp|P0CAX5|OPHN1_RAT Oligophrenin-1 OS=Rattus norvegicus GN=Ophn1 PE=1 SV=1 408 614 2.0E-12
sp|Q54NL0|GACT_DICDI Rho GTPase-activating protein gacT OS=Dictyostelium discoideum GN=gacT PE=3 SV=1 443 681 3.0E-12
sp|Q54YV1|GACII_DICDI Rho GTPase-activating protein gacII OS=Dictyostelium discoideum GN=gacII PE=3 SV=1 460 614 3.0E-12
sp|Q54G18|GACW_DICDI Rho GTPase-activating protein gacW OS=Dictyostelium discoideum GN=gacW PE=3 SV=1 464 686 3.0E-12
sp|D4A208|SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus GN=Srgap2 PE=1 SV=1 466 614 3.0E-12
sp|Q9CAX8|RGAP4_ARATH Rho GTPase-activating protein 4 OS=Arabidopsis thaliana GN=ROPGAP4 PE=2 SV=1 437 614 4.0E-12
sp|Q9VDS5|RG92B_DROME Rho GTPase-activating protein 92B OS=Drosophila melanogaster GN=RhoGAP92B PE=1 SV=1 446 617 5.0E-12
sp|Q9WVM1|RGAP1_MOUSE Rac GTPase-activating protein 1 OS=Mus musculus GN=Racgap1 PE=1 SV=1 466 640 5.0E-12
sp|Q3TBD2|HMHA1_MOUSE Minor histocompatibility protein HA-1 OS=Mus musculus GN=Hmha1 PE=1 SV=2 444 620 5.0E-12
sp|Q6GPD0|RHG32_XENLA Rho GTPase-activating protein 32 OS=Xenopus laevis GN=arhgap32 PE=2 SV=1 443 614 6.0E-12
sp|Q99J31|OPHN1_MOUSE Oligophrenin-1 OS=Mus musculus GN=Ophn1 PE=1 SV=1 470 614 6.0E-12
sp|Q54SL6|GACQ_DICDI Rho GTPase-activating protein gacQ OS=Dictyostelium discoideum GN=gacQ PE=3 SV=1 443 614 6.0E-12
sp|O75044|SRGP2_HUMAN SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens GN=SRGAP2 PE=1 SV=2 466 614 7.0E-12
sp|Q91Z67|SRGP2_MOUSE SLIT-ROBO Rho GTPase-activating protein 2 OS=Mus musculus GN=Srgap2 PE=1 SV=2 466 614 8.0E-12
sp|O94466|RGA7_SCHPO Probable Rho-GTPase-activating protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga7 PE=1 SV=1 445 614 1.0E-11
sp|Q2M1Z3|RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens GN=ARHGAP31 PE=1 SV=2 432 614 1.0E-11
sp|B0S6J3|SRGP2_DANRE SLIT-ROBO Rho GTPase-activating protein 2 OS=Danio rerio GN=srgap2 PE=2 SV=1 466 670 1.0E-11
sp|Q7Z6B7|SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens GN=SRGAP1 PE=1 SV=1 465 632 2.0E-11
sp|P46941|TG325_CAEEL WW domain-containing protein tag-325 OS=Caenorhabditis elegans GN=tag-325 PE=3 SV=1 466 614 2.0E-11
sp|Q8N103|TAGAP_HUMAN T-cell activation Rho GTPase-activating protein OS=Homo sapiens GN=TAGAP PE=1 SV=1 465 614 2.0E-11
sp|Q9BRR9|RHG09_HUMAN Rho GTPase-activating protein 9 OS=Homo sapiens GN=ARHGAP9 PE=1 SV=2 444 617 2.0E-11
sp|Q6DFV3|RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus GN=Arhgap21 PE=1 SV=1 446 632 3.0E-11
sp|Q5T5U3|RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens GN=ARHGAP21 PE=1 SV=1 446 632 3.0E-11
sp|Q63358|MYO9B_RAT Unconventional myosin-IXb OS=Rattus norvegicus GN=Myo9b PE=1 SV=1 446 614 3.0E-11
sp|Q08DP6|RHG10_BOVIN Rho GTPase-activating protein 10 OS=Bos taurus GN=ARHGAP10 PE=2 SV=1 468 617 3.0E-11
sp|Q54BF1|GACE_DICDI Rho GTPase-activating protein gacE OS=Dictyostelium discoideum GN=gacE PE=3 SV=1 457 614 3.0E-11
sp|Q6DE55|HMHA1_XENLA Minor histocompatibility protein HA-1 OS=Xenopus laevis GN=hmha1 PE=2 SV=1 445 620 3.0E-11
sp|Q7YQL5|OPHN1_PONPY Oligophrenin-1 OS=Pongo pygmaeus GN=OPHN1 PE=2 SV=1 470 614 4.0E-11
sp|Q7YQL6|OPHN1_PANTR Oligophrenin-1 OS=Pan troglodytes GN=OPHN1 PE=2 SV=1 470 614 4.0E-11
sp|Q54WY8|GACN_DICDI Rho GTPase-activating protein gacN OS=Dictyostelium discoideum GN=gacN PE=3 SV=1 468 614 4.0E-11
sp|O60890|OPHN1_HUMAN Oligophrenin-1 OS=Homo sapiens GN=OPHN1 PE=1 SV=1 470 614 4.0E-11
sp|P34288|PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans GN=pac-1 PE=1 SV=4 466 618 4.0E-11
sp|Q9QY06|MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus GN=Myo9b PE=1 SV=2 446 614 4.0E-11
sp|Q811P8|RHG32_MOUSE Rho GTPase-activating protein 32 OS=Mus musculus GN=Arhgap32 PE=1 SV=2 443 614 4.0E-11
sp|Q6DFG0|RH21A_XENLA Rho GTPase-activating protein 21-A OS=Xenopus laevis GN=arhgap21-a PE=2 SV=1 446 614 4.0E-11
sp|Q6ZQ82|RHG26_MOUSE Rho GTPase-activating protein 26 OS=Mus musculus GN=Arhgap26 PE=1 SV=3 468 668 5.0E-11
sp|A7KAX9|RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens GN=ARHGAP32 PE=1 SV=1 443 614 5.0E-11
sp|A1A4S6|RHG10_HUMAN Rho GTPase-activating protein 10 OS=Homo sapiens GN=ARHGAP10 PE=1 SV=1 468 617 6.0E-11
sp|Q96P48|ARAP1_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=ARAP1 PE=1 SV=3 466 637 6.0E-11
sp|Q8K2H3|FA13B_MOUSE Protein FAM13B OS=Mus musculus GN=Fam13b PE=1 SV=1 444 614 7.0E-11
sp|Q13459|MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3 446 614 9.0E-11
sp|Q71M21|RH21B_XENLA Rho GTPase-activating protein 21-B OS=Xenopus laevis GN=arhgap21-b PE=2 SV=1 441 614 1.0E-10
sp|Q91Z69|SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus GN=Srgap1 PE=1 SV=2 465 632 1.0E-10
sp|Q9VIS1|CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster GN=CdGAPr PE=1 SV=2 466 614 2.0E-10
sp|Q6Y5D8|RHG10_MOUSE Rho GTPase-activating protein 10 OS=Mus musculus GN=Arhgap10 PE=1 SV=2 468 617 2.0E-10
sp|Q9UNA1|RHG26_HUMAN Rho GTPase-activating protein 26 OS=Homo sapiens GN=ARHGAP26 PE=1 SV=1 468 668 2.0E-10
sp|Q9NYF5|FA13B_HUMAN Protein FAM13B OS=Homo sapiens GN=FAM13B PE=2 SV=2 444 614 2.0E-10
sp|Q559A0|GACU_DICDI Rho GTPase-activating protein gacU OS=Dictyostelium discoideum GN=gacU PE=3 SV=1 445 634 2.0E-10
sp|A6X8Z5|RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus GN=Arhgap31 PE=1 SV=1 466 614 2.0E-10
sp|A2RUV4|RHG21_XENTR Rho GTPase-activating protein 21 OS=Xenopus tropicalis GN=arhgap21 PE=2 SV=1 441 614 3.0E-10
sp|B5DFQ4|RHG26_XENTR Rho GTPase-activating protein 26 OS=Xenopus tropicalis GN=arhgap26 PE=2 SV=1 468 668 3.0E-10
sp|Q6NKT5|RGAP5_ARATH Rho GTPase-activating protein 5 OS=Arabidopsis thaliana GN=ROPGAP5 PE=2 SV=1 437 615 3.0E-10
sp|Q4LDD4|ARAP1_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus GN=Arap1 PE=1 SV=2 466 637 4.0E-10
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 469 614 4.0E-10
sp|Q9FMR1|RGAP1_ARATH Rho GTPase-activating protein 1 OS=Arabidopsis thaliana GN=ROPGAP1 PE=2 SV=1 437 614 4.0E-10
sp|Q6PCS4|RHG29_DANRE Rho GTPase-activating protein 29 OS=Danio rerio GN=arhgap29 PE=2 SV=1 466 634 5.0E-10
sp|O43295|SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens GN=SRGAP3 PE=1 SV=3 466 617 5.0E-10
sp|Q5U4T3|RHG26_XENLA Rho GTPase-activating protein 26 OS=Xenopus laevis GN=arhgap26 PE=2 SV=1 468 668 8.0E-10
sp|Q54PG5|GACC_DICDI Rho GTPase-activating protein gacC OS=Dictyostelium discoideum GN=gacC PE=3 SV=1 446 614 1.0E-09
sp|Q8K0Q5|RHG18_MOUSE Rho GTPase-activating protein 18 OS=Mus musculus GN=Arhgap18 PE=1 SV=1 445 614 1.0E-09
sp|Q54XT6|GACR_DICDI Rho GTPase-activating protein gacR OS=Dictyostelium discoideum GN=gacR PE=3 SV=1 436 617 1.0E-09
sp|B2RTY4|MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens GN=MYO9A PE=1 SV=2 433 614 1.0E-09
sp|Q5ZMW5|RHG26_CHICK Rho GTPase-activating protein 26 OS=Gallus gallus GN=ARHGAP26 PE=1 SV=2 468 614 1.0E-09
sp|Q54MV3|GACJ_DICDI Rho GTPase-activating protein gacJ OS=Dictyostelium discoideum GN=gacJ PE=3 SV=1 402 614 2.0E-09
sp|Q9Z1N3|MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus GN=Myo9a PE=1 SV=1 438 614 3.0E-09
sp|Q80Y19|RHGBA_MOUSE Rho GTPase-activating protein 11A OS=Mus musculus GN=Arhgap11a PE=1 SV=2 480 614 3.0E-09
sp|Q812A2|SRGP3_MOUSE SLIT-ROBO Rho GTPase-activating protein 3 OS=Mus musculus GN=Srgap3 PE=1 SV=1 466 617 3.0E-09
sp|Q8C170|MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus GN=Myo9a PE=1 SV=2 438 614 4.0E-09
sp|P85298|RHG08_HUMAN Rho GTPase-activating protein 8 OS=Homo sapiens GN=ARHGAP8 PE=1 SV=1 466 632 5.0E-09
sp|Q54QF4|MGP4_DICDI Mental retardation GTPase activating protein homolog 4 OS=Dictyostelium discoideum GN=mgp4 PE=3 SV=1 469 614 5.0E-09
sp|Q6P4F7|RHGBA_HUMAN Rho GTPase-activating protein 11A OS=Homo sapiens GN=ARHGAP11A PE=1 SV=2 483 614 8.0E-09
sp|Q9HF75|BEM2_ASHGO GTPase-activating protein BEM2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BEM2 PE=3 SV=1 440 610 8.0E-09
sp|Q20498|RRC1_CAEEL GTPase-activating protein rrc-1 OS=Caenorhabditis elegans GN=rrc-1 PE=1 SV=3 440 641 1.0E-08
sp|A6NI28|RHG42_HUMAN Rho GTPase-activating protein 42 OS=Homo sapiens GN=ARHGAP42 PE=1 SV=3 470 632 1.0E-08
sp|Q54E35|GACEE_DICDI Rho GTPase-activating protein gacEE OS=Dictyostelium discoideum GN=gacEE PE=3 SV=2 437 614 1.0E-08
sp|Q54J98|GACX_DICDI Rho GTPase-activating protein gacX OS=Dictyostelium discoideum GN=gacX PE=3 SV=1 463 614 2.0E-08
sp|Q8N392|RHG18_HUMAN Rho GTPase-activating protein 18 OS=Homo sapiens GN=ARHGAP18 PE=1 SV=3 464 614 2.0E-08
sp|Q5PQJ5|RHG29_RAT Rho GTPase-activating protein 29 OS=Rattus norvegicus GN=Arhgap29 PE=1 SV=2 444 619 2.0E-08
sp|Q8BN58|RHG28_MOUSE Rho GTPase-activating protein 28 OS=Mus musculus GN=Arhgap28 PE=1 SV=1 464 614 3.0E-08
sp|Q5TG30|RHG40_HUMAN Rho GTPase-activating protein 40 OS=Homo sapiens GN=ARHGAP40 PE=3 SV=3 429 614 3.0E-08
sp|Q3KRB8|RHGBB_HUMAN Rho GTPase-activating protein 11B OS=Homo sapiens GN=ARHGAP11B PE=2 SV=1 483 614 4.0E-08
sp|B2RQE8|RHG42_MOUSE Rho GTPase-activating protein 42 OS=Mus musculus GN=Arhgap42 PE=1 SV=1 468 632 4.0E-08
sp|Q07960|RHG01_HUMAN Rho GTPase-activating protein 1 OS=Homo sapiens GN=ARHGAP1 PE=1 SV=1 466 614 4.0E-08
sp|O43182|RHG06_HUMAN Rho GTPase-activating protein 6 OS=Homo sapiens GN=ARHGAP6 PE=1 SV=3 466 614 5.0E-08
sp|F4JI46|RGAP2_ARATH Rho GTPase-activating protein 2 OS=Arabidopsis thaliana GN=ROPGAP2 PE=1 SV=1 445 614 5.0E-08
sp|Q8CGF1|RHG29_MOUSE Rho GTPase-activating protein 29 OS=Mus musculus GN=Arhgap29 PE=1 SV=1 444 619 6.0E-08
sp|A7YY57|RHG29_BOVIN Rho GTPase-activating protein 29 OS=Bos taurus GN=ARHGAP29 PE=2 SV=1 466 619 6.0E-08
sp|Q9VX32|RG190_DROME Rho GTPase-activating protein 190 OS=Drosophila melanogaster GN=RhoGAPp190 PE=1 SV=2 466 629 7.0E-08
sp|O54834|RHG06_MOUSE Rho GTPase-activating protein 6 OS=Mus musculus GN=Arhgap6 PE=1 SV=3 466 614 1.0E-07
sp|E9Q6X9|RHG40_MOUSE Rho GTPase-activating protein 40 OS=Mus musculus GN=Arhgap40 PE=3 SV=1 480 617 1.0E-07
sp|Q92502|STAR8_HUMAN StAR-related lipid transfer protein 8 OS=Homo sapiens GN=STARD8 PE=1 SV=2 461 614 1.0E-07
sp|Q6ZM89|RH42A_DANRE Rho GTPase-activating protein 42 OS=Danio rerio GN=arhgap42a PE=2 SV=3 468 614 1.0E-07
sp|Q54F80|GACD_DICDI Rho GTPase-activating protein gacD OS=Dictyostelium discoideum GN=gacD PE=2 SV=1 470 614 2.0E-07
sp|P39960|BEM2_YEAST GTPase-activating protein BEM2/IPL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BEM2 PE=1 SV=1 440 610 2.0E-07
sp|Q96QB1|RHG07_HUMAN Rho GTPase-activating protein 7 OS=Homo sapiens GN=DLC1 PE=1 SV=4 437 614 3.0E-07
sp|Q5FWK3|RHG01_MOUSE Rho GTPase-activating protein 1 OS=Mus musculus GN=Arhgap1 PE=1 SV=1 444 614 6.0E-07
sp|Q9DBZ9|SYDE1_MOUSE Rho GTPase-activating protein SYDE1 OS=Mus musculus GN=Syde1 PE=1 SV=1 437 618 7.0E-07
sp|Q9Y3M8|STA13_HUMAN StAR-related lipid transfer protein 13 OS=Homo sapiens GN=STARD13 PE=1 SV=2 437 614 8.0E-07
sp|Q63744|RHG07_RAT Rho GTPase-activating protein 7 OS=Rattus norvegicus GN=Dlc1 PE=1 SV=3 437 614 8.0E-07
sp|Q8K031|STAR8_MOUSE StAR-related lipid transfer protein 8 OS=Mus musculus GN=Stard8 PE=1 SV=2 461 614 9.0E-07
sp|P38339|RGD1_YEAST RHO GTPase-activating protein RGD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGD1 PE=1 SV=1 466 614 1.0E-06
sp|Q923Q2|STA13_MOUSE StAR-related lipid transfer protein 13 OS=Mus musculus GN=Stard13 PE=1 SV=5 437 614 1.0E-06
sp|Q9CXP4|RHG08_MOUSE Rho GTPase-activating protein 8 OS=Mus musculus GN=Arhgap8 PE=2 SV=3 466 619 1.0E-06
sp|A7E300|RHG07_BOVIN Rho GTPase-activating protein 7 OS=Bos taurus GN=DLC1 PE=2 SV=1 437 614 2.0E-06
sp|Q9R0Z9|RHG07_MOUSE Rho GTPase-activating protein 7 OS=Mus musculus GN=Dlc1 PE=1 SV=2 437 614 3.0E-06
sp|Q8BRH3|RHG19_MOUSE Rho GTPase-activating protein 19 OS=Mus musculus GN=Arhgap19 PE=1 SV=2 470 626 4.0E-06
sp|A7MB27|RHG36_BOVIN Rho GTPase-activating protein 36 OS=Bos taurus GN=ARHGAP36 PE=2 SV=1 466 610 4.0E-06
sp|Q54Y72|GACA_DICDI Rho GTPase-activating protein gacA OS=Dictyostelium discoideum GN=gacA PE=3 SV=1 482 614 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0065007 biological regulation No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5939
MATRTAPLDEALKNLPRNSVDSAISTASSIPAENPEHVQTSSSEIANLFRSAGGPEPLVQHLLRERTSMYQQNSQ
LWKAVTEQRAMIVRLNKNAELASQEKEKYKAAFDNLVTNLALFKSPEADGESSTSSLENMARPSWNIPTSMAQHG
APPDLQTYFLGNGVQNDLSSELPIASHLMAPPVDRHDPRSVLDSLLDPGHFLPQPQALPSNKFGQDAVERAQVDK
QNDDSWINPSVSLESSQSPHGEPVNVTLPKAPDSMSGPPPYPGFEFNLPGAGLPEFRTDEARTENDDTDSVTEVQ
EITEHIHVHASVRQDNYQEEQDVIAAETAKEISVLKEGDQWKPEIHTGMLDQPATMDLAGERKSSENLSTTIPGP
EKMKLLNASAWVNSQDVTGYMVGHTNDNKKQKKRGLFKIGPNTRDSQDSSVGGSESGSSAAAPRRSTQQIFGMSL
DEAARWYSPTRTEITLPSVVYRCIQFLNSKNAIREEGIFRLSGSSSTIKKLRELFNTHGDLNLLAEDLDLPVDTS
AVTSLLKLYLRELPELILPRDLQWQFLSIAEFPEGNEKTAALIQLAKKLPHANAILFKHLFSLLTRIINREHVNK
MNARNVGIVFLPTLNIPAPVFSMFLQHYETFFGVDAESCELPELPEVPETEALRESFDAPPRPSTASRSDAAPVR
HLTTPGRASPHLLTRTDSRDTMESDQTVRRAPVLAQGAPKLRFRCGFGGQLANASRY*
Coding >Hirsu2|5939
ATGGCCACTCGCACAGCGCCTCTTGATGAGGCCTTGAAAAATCTACCACGGAATTCCGTCGATTCTGCTATTTCA
ACAGCTTCTTCGATACCTGCTGAAAACCCGGAGCATGTTCAAACAAGTTCTTCAGAGATTGCCAACCTTTTCAGG
TCGGCAGGGGGACCGGAACCCCTCGTTCAGCACTTACTTAGAGAGAGAACTTCGATGTATCAGCAGAATTCCCAG
CTGTGGAAAGCAGTAACCGAACAGAGAGCCATGATAGTACGGCTGAACAAAAACGCTGAACTTGCCTCTCAGGAG
AAGGAAAAGTACAAAGCAGCATTCGATAACTTGGTCACTAACCTGGCTTTATTTAAATCCCCCGAAGCTGACGGC
GAATCCAGTACTTCGTCCCTTGAGAATATGGCCCGGCCTTCTTGGAATATCCCTACTTCGATGGCTCAACATGGT
GCTCCCCCGGATCTTCAGACATATTTCCTCGGCAATGGTGTACAGAACGACCTATCAAGCGAGTTACCTATAGCA
TCTCATCTAATGGCACCACCTGTCGATAGACATGACCCACGATCCGTTTTAGACTCGCTCCTAGATCCCGGCCAC
TTTTTGCCCCAACCTCAAGCCCTCCCCTCCAACAAATTCGGTCAAGACGCAGTGGAAAGAGCGCAGGTTGATAAA
CAGAACGACGATAGCTGGATAAACCCCAGCGTCTCCCTCGAGTCGTCCCAGAGCCCACATGGTGAGCCAGTAAAT
GTCACCTTGCCAAAGGCCCCCGATTCGATGTCCGGTCCCCCGCCCTACCCAGGATTCGAATTTAACCTGCCAGGC
GCGGGGCTGCCTGAGTTCCGGACAGACGAGGCCCGCACTGAAAATGACGACACAGACTCCGTCACGGAAGTACAA
GAAATTACGGAACATATCCATGTTCATGCCAGTGTACGCCAAGACAACTATCAAGAAGAGCAAGACGTGATTGCC
GCCGAGACAGCCAAAGAAATAAGCGTCCTAAAGGAAGGCGACCAATGGAAACCCGAGATACATACTGGGATGTTG
GATCAGCCCGCCACTATGGACCTAGCAGGGGAGAGAAAAAGCTCCGAGAATTTGAGCACGACGATTCCTGGGCCG
GAGAAGATGAAGCTTCTCAACGCTTCTGCCTGGGTCAATTCACAAGATGTGACGGGATACATGGTGGGACACACA
AATGATAATAAAAAGCAAAAGAAACGAGGGCTGTTCAAGATCGGACCAAACACACGGGACAGCCAAGACTCATCA
GTGGGCGGAAGCGAGTCTGGCTCTTCAGCTGCAGCCCCGCGGAGGTCTACTCAACAGATATTCGGGATGTCCTTA
GATGAAGCCGCTCGATGGTATTCTCCGACACGAACCGAAATTACCCTCCCTTCCGTGGTGTATCGATGCATCCAA
TTCCTAAACAGTAAGAACGCGATTCGAGAAGAGGGCATCTTCAGACTCAGCGGCTCCAGCTCGACTATCAAGAAA
TTACGCGAACTTTTCAACACTCATGGGGACCTGAATCTGCTGGCAGAAGATCTGGACCTACCCGTGGATACGTCT
GCTGTTACATCTCTTCTGAAGTTATACCTTAGGGAGCTCCCAGAGCTCATCCTCCCAAGGGATCTTCAGTGGCAA
TTTTTAAGCATTGCAGAGTTTCCTGAGGGCAACGAAAAGACGGCAGCCTTGATTCAACTGGCGAAGAAACTACCA
CATGCTAACGCGATACTCTTTAAGCACTTATTTTCTCTCTTGACAAGGATAATAAATAGGGAACACGTGAATAAG
ATGAACGCCCGCAACGTAGGCATCGTCTTTTTACCGACATTGAACATTCCAGCACCGGTTTTCTCCATGTTCCTT
CAGCACTACGAGACCTTCTTCGGCGTCGACGCCGAGTCCTGCGAGCTCCCTGAGCTCCCCGAGGTCCCAGAGACA
GAGGCGCTACGGGAAAGCTTCGATGCTCCGCCACGCCCAAGCACCGCGTCGCGATCCGATGCTGCACCAGTCCGA
CATCTAACTACACCAGGCCGTGCGTCTCCTCATCTTTTAACGAGAACAGACTCAAGAGACACTATGGAATCCGAC
CAGACAGTCCGCCGGGCCCCTGTGCTGGCACAGGGCGCGCCTAAACTGCGATTTAGATGCGGTTTCGGGGGACAA
CTGGCGAATGCCTCCCGCTATTAA
Transcript >Hirsu2|5939
ATGGCCACTCGCACAGCGCCTCTTGATGAGGCCTTGAAAAATCTACCACGGAATTCCGTCGATTCTGCTATTTCA
ACAGCTTCTTCGATACCTGCTGAAAACCCGGAGCATGTTCAAACAAGTTCTTCAGAGATTGCCAACCTTTTCAGG
TCGGCAGGGGGACCGGAACCCCTCGTTCAGCACTTACTTAGAGAGAGAACTTCGATGTATCAGCAGAATTCCCAG
CTGTGGAAAGCAGTAACCGAACAGAGAGCCATGATAGTACGGCTGAACAAAAACGCTGAACTTGCCTCTCAGGAG
AAGGAAAAGTACAAAGCAGCATTCGATAACTTGGTCACTAACCTGGCTTTATTTAAATCCCCCGAAGCTGACGGC
GAATCCAGTACTTCGTCCCTTGAGAATATGGCCCGGCCTTCTTGGAATATCCCTACTTCGATGGCTCAACATGGT
GCTCCCCCGGATCTTCAGACATATTTCCTCGGCAATGGTGTACAGAACGACCTATCAAGCGAGTTACCTATAGCA
TCTCATCTAATGGCACCACCTGTCGATAGACATGACCCACGATCCGTTTTAGACTCGCTCCTAGATCCCGGCCAC
TTTTTGCCCCAACCTCAAGCCCTCCCCTCCAACAAATTCGGTCAAGACGCAGTGGAAAGAGCGCAGGTTGATAAA
CAGAACGACGATAGCTGGATAAACCCCAGCGTCTCCCTCGAGTCGTCCCAGAGCCCACATGGTGAGCCAGTAAAT
GTCACCTTGCCAAAGGCCCCCGATTCGATGTCCGGTCCCCCGCCCTACCCAGGATTCGAATTTAACCTGCCAGGC
GCGGGGCTGCCTGAGTTCCGGACAGACGAGGCCCGCACTGAAAATGACGACACAGACTCCGTCACGGAAGTACAA
GAAATTACGGAACATATCCATGTTCATGCCAGTGTACGCCAAGACAACTATCAAGAAGAGCAAGACGTGATTGCC
GCCGAGACAGCCAAAGAAATAAGCGTCCTAAAGGAAGGCGACCAATGGAAACCCGAGATACATACTGGGATGTTG
GATCAGCCCGCCACTATGGACCTAGCAGGGGAGAGAAAAAGCTCCGAGAATTTGAGCACGACGATTCCTGGGCCG
GAGAAGATGAAGCTTCTCAACGCTTCTGCCTGGGTCAATTCACAAGATGTGACGGGATACATGGTGGGACACACA
AATGATAATAAAAAGCAAAAGAAACGAGGGCTGTTCAAGATCGGACCAAACACACGGGACAGCCAAGACTCATCA
GTGGGCGGAAGCGAGTCTGGCTCTTCAGCTGCAGCCCCGCGGAGGTCTACTCAACAGATATTCGGGATGTCCTTA
GATGAAGCCGCTCGATGGTATTCTCCGACACGAACCGAAATTACCCTCCCTTCCGTGGTGTATCGATGCATCCAA
TTCCTAAACAGTAAGAACGCGATTCGAGAAGAGGGCATCTTCAGACTCAGCGGCTCCAGCTCGACTATCAAGAAA
TTACGCGAACTTTTCAACACTCATGGGGACCTGAATCTGCTGGCAGAAGATCTGGACCTACCCGTGGATACGTCT
GCTGTTACATCTCTTCTGAAGTTATACCTTAGGGAGCTCCCAGAGCTCATCCTCCCAAGGGATCTTCAGTGGCAA
TTTTTAAGCATTGCAGAGTTTCCTGAGGGCAACGAAAAGACGGCAGCCTTGATTCAACTGGCGAAGAAACTACCA
CATGCTAACGCGATACTCTTTAAGCACTTATTTTCTCTCTTGACAAGGATAATAAATAGGGAACACGTGAATAAG
ATGAACGCCCGCAACGTAGGCATCGTCTTTTTACCGACATTGAACATTCCAGCACCGGTTTTCTCCATGTTCCTT
CAGCACTACGAGACCTTCTTCGGCGTCGACGCCGAGTCCTGCGAGCTCCCTGAGCTCCCCGAGGTCCCAGAGACA
GAGGCGCTACGGGAAAGCTTCGATGCTCCGCCACGCCCAAGCACCGCGTCGCGATCCGATGCTGCACCAGTCCGA
CATCTAACTACACCAGGCCGTGCGTCTCCTCATCTTTTAACGAGAACAGACTCAAGAGACACTATGGAATCCGAC
CAGACAGTCCGCCGGGCCCCTGTGCTGGCACAGGGCGCGCCTAAACTGCGATTTAGATGCGGTTTCGGGGGACAA
CTGGCGAATGCCTCCCGCTATTAA
Gene >Hirsu2|5939
ATGGCCACTCGCACAGCGCCTCTTGATGAGGCCTTGAAAAATCTACCACGGAATTCCGTCGATTCTGCTATTTCA
ACAGCTTCTTCGATACCTGCTGAAAACCCGGAGCATGTTCAAACAAGTTCTTCAGAGATTGCCAACCTTTTCAGG
TCGGCAGGGGGACCGGAACCCCTCGTTCAGCACTTACTTAGAGAGAGAACTTCGATGTATCAGCAGAATTCCCAG
CTGTGGAAAGCAGTAACCGAACAGAGAGCCATGATAGTACGGCTGAACAAAAACGCTGAACTTGCCTCTCAGGAG
AAGGAAAAGTACAAAGCAGCATTCGATAACTTGGTCACTAACCTGGCTTTATTTAAATCCCCCGAAGCTGACGGC
GAATCCAGTACTTCGTCCCTTGAGAATATGGCCCGGCCTTCTTGGAATATCCCTACTTCGATGGCTCAACATGGT
GCTCCCCCGGATCTTCAGACATATTTCCTCGGCAATGGTGTACAGAACGACCTATCAAGCGAGTTACCTATAGCA
TCTCATCTAATGGCACCACCTGTCGATAGACATGACCCACGATCCGTTTTAGACTCGCTCCTAGATCCCGGCCAC
TTTTTGCCCCAACCTCAAGCCCTCCCCTCCAACAAATTCGGTCAAGACGCAGTGGAAAGAGCGCAGGTTGATAAA
CAGAACGACGATAGCTGGATAAACCCCAGCGTCTCCCTCGAGTCGTCCCAGAGCCCACATGGTGAGCCAGTAAAT
GTCACCTTGCCAAAGGCCCCCGATTCGATGTCCGGTCCCCCGCCCTACCCAGGATTCGAATTTAACCTGCCAGGC
GCGGGGCTGCCTGAGTTCCGGACAGACGAGGCCCGCACTGAAAATGACGACACAGACTCCGTCACGGAAGTACAA
GAAATTACGGAACATATCCATGTTCATGCCAGTGTACGCCAAGACAACTATCAAGAAGAGCAAGACGTGATTGCC
GCCGAGACAGCCAAAGAAATAAGCGTCCTAAAGGAAGGCGACCAATGGAAACCCGAGATACATACTGGGATGTTG
GATCAGCCCGCCACTATGGACCTAGCAGGGGAGAGAAAAAGCTCCGAGAATTTGAGCACGACGATTCCTGGGCCG
GAGAAGATGAAGCTTCTCAACGCTTCTGCCTGGGTCAATTCACAAGATGTGACGGGATACATGGTGGGACACACA
AATGATAATAAAAAGCAAAAGAAACGAGGGCTGTTCAAGATCGGACCAAACACACGGGACAGCCAAGACTCATCA
GTGGGCGGAAGCGAGTCTGGCTCTTCAGCTGCAGCCCCGCGGAGGTCTACTCAACAGATATTCGGGATGTCCTTA
GATGAAGCCGCTCGATGGTATTCTCCGACACGAACCGAAATTACCCTCCCTTCCGTGGTGTATCGATGCATCCAA
TTCCTAAACAGTAAGAACGCGATTCGAGAAGAGGGCATCTTCAGACTCAGCGGCTCCAGCTCGACTATCAAGAAA
TTACGCGAACTTTTCAACACTCATGGGGACCTGAATCTGCTGGCAGAAGATCTGGACCTACCCGTGGATACGTCT
GCTGTTACATCTCTTCTGAAGTTATACCTTAGGGAGCTCCCAGAGCTCATCCTCCCAAGGGATCTTCAGTGGCAA
TTTTTAAGCATTGCAGAGTTTCCTGAGGGCAACGAAAAGACGGCAGCCTTGATTCAACTGGCGAAGAAACTACCA
CATGCTAACGCGATACTCTTTAAGCACTTATTTTCTCTCTTGACAAGGATAATAAATAGGGAACACGTGAATAAG
ATGAACGCCCGCAACGTAGGCATCGTCTTTTTACCGACATTGAACATTCCAGCACCGGTTTTCTCCATGTTCCTT
CAGCACTACGAGACCTTCTTCGGCGTCGACGCCGAGTCCTGCGAGCTCCCTGAGCTCCCCGAGGTCCCAGAGACA
GAGGCGCTACGGGAAAGCTTCGATGCTCCGCCACGCCCAAGCACCGCGTCGCGATCCGATGCTGCACCAGTCCGA
CATCTAACTACACCAGGCCGTGCGTCTCCTCATCTTTTAACGAGAACAGACTCAAGAGACACTATGGAATCCGAC
CAGACAGTCCGCCGGGCCCCTGTGCTGGCACAGGGCGCGCCTAAACTGCGATTTAGATGCGGTTTCGGGGGACAA
CTGGCGAATGCCTCCCGCTATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail