Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5936
Gene name
LocationContig_3:84199..85386
Strand+
Gene length (bp)1187
Transcript length (bp)843
Coding sequence length (bp)843
Protein length (aa) 281

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01965 DJ-1_PfpI DJ-1/PfpI family 3.8E-19 41 221

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8G9F9|INHA_PSEPU Isonitrile hydratase OS=Pseudomonas putida GN=inhA PE=1 SV=1 35 243 6.0E-23
sp|Q9V1F8|PFPI_PYRAB Intracellular protease 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pfpI PE=3 SV=1 50 224 2.0E-08
sp|O59413|PFPI_PYRHO Intracellular protease 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pfpI PE=1 SV=1 52 224 3.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5936
MARLQRAFFLFCIPGLLAAVGARETEGQWCKAGHSLSLGISVFPGFEPLDVFGPLEVFYALSYHRNVSLAVIAKE
KGLVSSRPPFKTGSKNATNGYENALGPRIEATHSFSEAPVLDVLLVPGGRGTSALEQANDTSVEDFIKSTFGQLD
FLLSVCTGAVSLAKAGVLSGRRATTNKSVWKAATNHGKNVTWVPTARWVEDGNIWTSSGVSAGIDMTYAFLRRLY
GDGDEILKSVMNEIEYAPHTKADWDPFSVVHKVPGANTMASLADSTTPVGYDENS*
Coding >Hirsu2|5936
ATGGCCAGATTGCAACGTGCTTTCTTCCTCTTCTGTATTCCGGGCTTACTCGCCGCTGTGGGGGCTAGAGAGACT
GAGGGACAATGGTGCAAAGCCGGGCATTCTCTCTCTCTTGGCATTTCAGTGTTTCCCGGATTCGAGCCTCTCGAT
GTCTTCGGCCCCCTGGAAGTATTCTACGCGTTATCCTATCATCGTAATGTATCCCTTGCGGTAATCGCAAAAGAA
AAGGGACTGGTGAGCTCCCGTCCACCTTTCAAGACAGGGTCGAAAAATGCAACGAACGGCTACGAAAATGCTCTG
GGGCCAAGAATAGAGGCTACGCATTCCTTTTCCGAAGCTCCAGTACTGGATGTCCTGCTTGTGCCGGGAGGTCGC
GGAACCAGTGCCCTTGAGCAGGCAAACGACACCTCAGTCGAGGACTTTATCAAAAGCACCTTTGGTCAGTTGGAC
TTCCTACTCAGCGTTTGCACTGGGGCTGTCAGCTTAGCCAAAGCCGGCGTGCTTTCCGGCCGTCGAGCGACGACA
AACAAGAGCGTTTGGAAAGCGGCTACAAATCATGGGAAAAACGTCACCTGGGTGCCTACAGCCCGCTGGGTTGAA
GACGGAAACATTTGGACGAGCTCTGGAGTCTCCGCTGGGATAGATATGACCTACGCCTTTCTCAGGCGTTTATAC
GGCGACGGCGACGAGATTTTGAAGAGCGTTATGAACGAGATAGAATACGCGCCTCACACGAAAGCGGACTGGGAC
CCGTTTTCAGTAGTTCATAAGGTCCCCGGCGCGAACACGATGGCAAGTTTAGCCGACTCAACCACACCGGTTGGG
TACGATGAAAACTCTTAA
Transcript >Hirsu2|5936
ATGGCCAGATTGCAACGTGCTTTCTTCCTCTTCTGTATTCCGGGCTTACTCGCCGCTGTGGGGGCTAGAGAGACT
GAGGGACAATGGTGCAAAGCCGGGCATTCTCTCTCTCTTGGCATTTCAGTGTTTCCCGGATTCGAGCCTCTCGAT
GTCTTCGGCCCCCTGGAAGTATTCTACGCGTTATCCTATCATCGTAATGTATCCCTTGCGGTAATCGCAAAAGAA
AAGGGACTGGTGAGCTCCCGTCCACCTTTCAAGACAGGGTCGAAAAATGCAACGAACGGCTACGAAAATGCTCTG
GGGCCAAGAATAGAGGCTACGCATTCCTTTTCCGAAGCTCCAGTACTGGATGTCCTGCTTGTGCCGGGAGGTCGC
GGAACCAGTGCCCTTGAGCAGGCAAACGACACCTCAGTCGAGGACTTTATCAAAAGCACCTTTGGTCAGTTGGAC
TTCCTACTCAGCGTTTGCACTGGGGCTGTCAGCTTAGCCAAAGCCGGCGTGCTTTCCGGCCGTCGAGCGACGACA
AACAAGAGCGTTTGGAAAGCGGCTACAAATCATGGGAAAAACGTCACCTGGGTGCCTACAGCCCGCTGGGTTGAA
GACGGAAACATTTGGACGAGCTCTGGAGTCTCCGCTGGGATAGATATGACCTACGCCTTTCTCAGGCGTTTATAC
GGCGACGGCGACGAGATTTTGAAGAGCGTTATGAACGAGATAGAATACGCGCCTCACACGAAAGCGGACTGGGAC
CCGTTTTCAGTAGTTCATAAGGTCCCCGGCGCGAACACGATGGCAAGTTTAGCCGACTCAACCACACCGGTTGGG
TACGATGAAAACTCTTAA
Gene >Hirsu2|5936
ATGGCCAGATTGCAACGTGCTTTCTTCCTCTTCTGTATTCCGGGCTTACTCGCCGCTGTGGGGGCTAGAGAGACT
GAGGGACAATGGTGCAAAGCCGGGCATTCTCTCTCTCTTGGCATTGTACGTACGCTCCGACGTCGACTTCACCTC
AACAGATCAAAAAGACAAATCCAAAAGTCAAAAGAGCTAAAAATCAAACTAGTCAGTGTTTCCCGGATTCGAGCC
TCTCGATGTCTTCGGCCCCCTGGAAGTATTCTACGCGGTACGAAAGCAATTTTACCAATCTGAAGCCGCCAGGTC
CGCCGCAATGAGGCCAGCAGTCTACACATTTCCATCTAACGCGGTTACACGTGCAGTTATCCTATCATCGTAATG
TATCCCTTGCGGTAATCGCAAAAGAAAAGGGACTGGTGAGCTCCCGTCCACCTTTCAAGACAGGGTCGAAAAATG
CAACGAACGGCTACGAAAATGCTCTGGGGCCAAGAATAGAGGCTACGCATTCCTTTTCCGAAGCTCCAGTACTGG
ATGTCCTGCTTGTGCCGGGAGGTCGCGGAACCAGTGCCCTTGAGCAGGCAAACGACACCTCAGTCGAGGACTTTA
TCAAAAGCACCTTTGGTCAGTTGGACTTCCTACTCAGCGTTTGCACTGGGGCTGTCAGCTTAGCCAAAGCCGGCG
TGCTTTCCGGCCGTCGAGCGACGACAAACAAGAGCGTTTGGAAAGCGGCTACAAATCATGGGAAAAACGTCACCT
GGGTGCCTACAGCCCGCTGGGTTGAAGACGGAAACATTTGGACGAGCTCTGGAGTCTCCGCTGGTAAGTTTAGCA
ACCATAGTGATGTGAAAAGCCGTCGTGCATAACACAAATCTCTCTCGTAGAGAAACTTTTGAGCAGCTGCTCAGG
TCGCTGCGGGCTACCTAACTGATCTCTTTGCAGGGATAGATATGACCTACGCCTTTCTCAGGCGTTTATACGGCG
ACGGCGACGAGATTTTGAAGAGCGTTATGAACGAGATAGAATACGCGCCTCACACGAAAGCGGACTGGGACCCGT
TTTCAGTAGTTCATAAGGTATTTCACGAATTTGAACAAGATCTGCCATATACTCATCGTCGATAGGTCCCCGGCG
CGAACACGATGGCAAGTTTAGCCGACTCAACCACACCGGTTGGGTACGATGAAAACTCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail