Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5934
Gene name
LocationContig_3:77141..78806
Strand-
Gene length (bp)1665
Transcript length (bp)1665
Coding sequence length (bp)1665
Protein length (aa) 555

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08214 HAT_KAT11 Histone acetylation protein 3.3E-93 16 396

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7Y5|RT109_SCHPO Histone acetyltransferase rtt109 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rtt109 PE=3 SV=1 85 319 4.0E-31
sp|Q07794|RT109_YEAST Histone acetyltransferase RTT109 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTT109 PE=1 SV=1 151 309 1.0E-11
sp|Q5AAJ8|RT109_CANAL Histone acetyltransferase RTT109 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RTT109 PE=3 SV=1 118 319 2.0E-11

GO

GO Term Description Terminal node
GO:0016573 histone acetylation Yes
GO:0004402 histone acetyltransferase activity Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008152 metabolic process No
GO:0010468 regulation of gene expression No
GO:0043543 protein acylation No
GO:0016410 N-acyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:0016407 acetyltransferase activity No
GO:0006473 protein acetylation No
GO:0019222 regulation of metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0050794 regulation of cellular process No
GO:0016570 histone modification No
GO:0018205 peptidyl-lysine modification No
GO:0044267 cellular protein metabolic process No
GO:0044238 primary metabolic process No
GO:0006475 internal protein amino acid acetylation No
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0008080 N-acetyltransferase activity No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0036211 protein modification process No
GO:0018394 peptidyl-lysine acetylation No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0060255 regulation of macromolecule metabolic process No
GO:0050789 regulation of biological process No
GO:0018393 internal peptidyl-lysine acetylation No
GO:0006464 cellular protein modification process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0018193 peptidyl-amino acid modification No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0016569 covalent chromatin modification No
GO:0034212 peptide N-acetyltransferase activity No
GO:0016747 transferase activity, transferring acyl groups other than amino-acyl groups No
GO:0003824 catalytic activity No
GO:0016043 cellular component organization No
GO:0071840 cellular component organization or biogenesis No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019538 protein metabolic process No
GO:0016746 transferase activity, transferring acyl groups No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0006325 chromatin organization No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0061733 peptide-lysine-N-acetyltransferase activity No
GO:0043412 macromolecule modification No
GO:0031323 regulation of cellular metabolic process No
GO:0065007 biological regulation No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5934
MAVPNDAAGSNDLRVRLAALLPKSHRFRFHHLSTPPSKTNALCSAPPNERPDRTFCEKHFLAVSVDASPAPTASP
NDASWSTKPTLILALEIFIYTTAHTTTLFISKADSTGFLSLLNLPKGTPSPIREICVAFIRYLVEKRRRKGLQFV
VSLFARAQDQYLFPGSIKHSGKHVLDDRGLVKWWCRILDQLLVSPHSGASAPSWKNVQGYLVVPGLEAVETRALI
PRYSAQSSSWILGHPLERISHYSREFDWVPPRCLIPRFPDDPKSRFRDELDEEASNSGSMQNMGTWRSVKSLDMF
WEVMGFRQECSSGRMTGFIWVVFDDEDSLQRAKSELDPPVPSTPTRKKAAPEVTPKTTPKKLVHLQGETAGTELI
ESCRGKKVGKTKVHKKTLRGSIKARQPRVKNVQRNYLTDRPVSSKYYFWPAPGRGERLVDKGDYKRIVELLLHLD
FATLDKATGSSKRWIAEAGMGMLWGFEVTGTKGPPLHSESEQGGHRPVHVNNLSGFVKRKRADAADHESRLALEQ
DSSMGTRCLIEDETQRDVQTELVTKKPKT*
Coding >Hirsu2|5934
ATGGCGGTGCCAAACGATGCGGCTGGCAGTAATGACTTGCGGGTGAGGTTAGCCGCGCTGCTACCCAAGAGCCAT
CGCTTCCGCTTCCACCATCTCTCGACGCCTCCCTCCAAGACCAACGCGCTGTGCTCCGCGCCGCCAAACGAGCGC
CCGGACCGAACCTTTTGCGAGAAGCATTTTCTAGCCGTCTCCGTCGACGCTTCCCCCGCACCGACCGCCTCTCCA
AACGACGCCTCGTGGTCGACGAAGCCGACGCTGATCCTGGCCCTCGAGATCTTCATATATACCACTGCACACACG
ACCACACTCTTCATCTCCAAGGCTGACTCGACCGGCTTTCTCAGCCTCCTGAATCTGCCAAAGGGCACACCGAGT
CCCATTCGAGAAATATGTGTCGCCTTTATCAGATACCTTGTTGAGAAAAGGCGGCGCAAGGGCTTGCAGTTTGTC
GTCAGCCTCTTTGCTCGTGCGCAGGATCAGTACCTTTTCCCAGGAAGCATCAAACACAGCGGCAAGCACGTCCTC
GATGATCGCGGCCTCGTAAAATGGTGGTGTCGCATCCTGGATCAGTTGCTCGTCTCGCCACATTCGGGCGCTTCA
GCGCCGTCATGGAAGAATGTTCAAGGCTATCTAGTCGTGCCCGGGCTCGAGGCTGTCGAAACCAGGGCGTTGATC
CCTAGATACTCCGCCCAATCCTCGTCATGGATCCTGGGCCATCCTCTTGAGCGCATTTCTCACTACAGTCGCGAG
TTCGACTGGGTACCCCCACGGTGCCTGATTCCTCGATTTCCCGATGACCCTAAATCTCGATTCCGTGATGAACTC
GACGAGGAGGCATCCAATTCCGGCTCAATGCAGAACATGGGCACCTGGAGAAGTGTCAAGTCCCTCGACATGTTC
TGGGAAGTCATGGGGTTCCGTCAGGAGTGCTCGAGCGGTAGGATGACGGGTTTCATCTGGGTCGTGTTCGATGAC
GAGGACAGCTTACAGCGCGCCAAGTCTGAGCTCGATCCTCCAGTTCCGTCTACGCCGACGCGAAAGAAGGCGGCG
CCCGAAGTCACACCAAAGACAACTCCGAAAAAGCTCGTCCATTTACAGGGAGAAACTGCCGGCACAGAGCTTATC
GAATCATGCCGAGGCAAAAAGGTCGGGAAGACAAAGGTCCACAAAAAGACACTACGAGGTAGCATCAAGGCCCGG
CAGCCTCGAGTCAAAAACGTGCAACGAAACTACTTGACGGACAGGCCTGTGTCGAGCAAGTACTACTTTTGGCCG
GCGCCAGGGAGAGGCGAGAGGTTAGTCGATAAAGGTGACTACAAACGAATCGTGGAGCTATTGCTCCACCTTGAT
TTCGCGACCCTGGACAAGGCCACCGGCAGCTCCAAGCGCTGGATCGCCGAGGCTGGCATGGGCATGCTTTGGGGC
TTCGAGGTGACAGGAACCAAGGGACCGCCTCTACACTCCGAGAGTGAGCAAGGCGGCCACAGACCCGTCCACGTC
AATAACCTCTCTGGGTTTGTCAAGAGAAAGAGGGCCGACGCGGCCGACCACGAGTCACGGTTGGCGCTAGAGCAG
GACAGCAGCATGGGCACCAGGTGTCTGATAGAAGATGAGACACAACGTGATGTGCAGACGGAGCTGGTGACCAAA
AAGCCAAAGACGTAA
Transcript >Hirsu2|5934
ATGGCGGTGCCAAACGATGCGGCTGGCAGTAATGACTTGCGGGTGAGGTTAGCCGCGCTGCTACCCAAGAGCCAT
CGCTTCCGCTTCCACCATCTCTCGACGCCTCCCTCCAAGACCAACGCGCTGTGCTCCGCGCCGCCAAACGAGCGC
CCGGACCGAACCTTTTGCGAGAAGCATTTTCTAGCCGTCTCCGTCGACGCTTCCCCCGCACCGACCGCCTCTCCA
AACGACGCCTCGTGGTCGACGAAGCCGACGCTGATCCTGGCCCTCGAGATCTTCATATATACCACTGCACACACG
ACCACACTCTTCATCTCCAAGGCTGACTCGACCGGCTTTCTCAGCCTCCTGAATCTGCCAAAGGGCACACCGAGT
CCCATTCGAGAAATATGTGTCGCCTTTATCAGATACCTTGTTGAGAAAAGGCGGCGCAAGGGCTTGCAGTTTGTC
GTCAGCCTCTTTGCTCGTGCGCAGGATCAGTACCTTTTCCCAGGAAGCATCAAACACAGCGGCAAGCACGTCCTC
GATGATCGCGGCCTCGTAAAATGGTGGTGTCGCATCCTGGATCAGTTGCTCGTCTCGCCACATTCGGGCGCTTCA
GCGCCGTCATGGAAGAATGTTCAAGGCTATCTAGTCGTGCCCGGGCTCGAGGCTGTCGAAACCAGGGCGTTGATC
CCTAGATACTCCGCCCAATCCTCGTCATGGATCCTGGGCCATCCTCTTGAGCGCATTTCTCACTACAGTCGCGAG
TTCGACTGGGTACCCCCACGGTGCCTGATTCCTCGATTTCCCGATGACCCTAAATCTCGATTCCGTGATGAACTC
GACGAGGAGGCATCCAATTCCGGCTCAATGCAGAACATGGGCACCTGGAGAAGTGTCAAGTCCCTCGACATGTTC
TGGGAAGTCATGGGGTTCCGTCAGGAGTGCTCGAGCGGTAGGATGACGGGTTTCATCTGGGTCGTGTTCGATGAC
GAGGACAGCTTACAGCGCGCCAAGTCTGAGCTCGATCCTCCAGTTCCGTCTACGCCGACGCGAAAGAAGGCGGCG
CCCGAAGTCACACCAAAGACAACTCCGAAAAAGCTCGTCCATTTACAGGGAGAAACTGCCGGCACAGAGCTTATC
GAATCATGCCGAGGCAAAAAGGTCGGGAAGACAAAGGTCCACAAAAAGACACTACGAGGTAGCATCAAGGCCCGG
CAGCCTCGAGTCAAAAACGTGCAACGAAACTACTTGACGGACAGGCCTGTGTCGAGCAAGTACTACTTTTGGCCG
GCGCCAGGGAGAGGCGAGAGGTTAGTCGATAAAGGTGACTACAAACGAATCGTGGAGCTATTGCTCCACCTTGAT
TTCGCGACCCTGGACAAGGCCACCGGCAGCTCCAAGCGCTGGATCGCCGAGGCTGGCATGGGCATGCTTTGGGGC
TTCGAGGTGACAGGAACCAAGGGACCGCCTCTACACTCCGAGAGTGAGCAAGGCGGCCACAGACCCGTCCACGTC
AATAACCTCTCTGGGTTTGTCAAGAGAAAGAGGGCCGACGCGGCCGACCACGAGTCACGGTTGGCGCTAGAGCAG
GACAGCAGCATGGGCACCAGGTGTCTGATAGAAGATGAGACACAACGTGATGTGCAGACGGAGCTGGTGACCAAA
AAGCCAAAGACGTAA
Gene >Hirsu2|5934
ATGGCGGTGCCAAACGATGCGGCTGGCAGTAATGACTTGCGGGTGAGGTTAGCCGCGCTGCTACCCAAGAGCCAT
CGCTTCCGCTTCCACCATCTCTCGACGCCTCCCTCCAAGACCAACGCGCTGTGCTCCGCGCCGCCAAACGAGCGC
CCGGACCGAACCTTTTGCGAGAAGCATTTTCTAGCCGTCTCCGTCGACGCTTCCCCCGCACCGACCGCCTCTCCA
AACGACGCCTCGTGGTCGACGAAGCCGACGCTGATCCTGGCCCTCGAGATCTTCATATATACCACTGCACACACG
ACCACACTCTTCATCTCCAAGGCTGACTCGACCGGCTTTCTCAGCCTCCTGAATCTGCCAAAGGGCACACCGAGT
CCCATTCGAGAAATATGTGTCGCCTTTATCAGATACCTTGTTGAGAAAAGGCGGCGCAAGGGCTTGCAGTTTGTC
GTCAGCCTCTTTGCTCGTGCGCAGGATCAGTACCTTTTCCCAGGAAGCATCAAACACAGCGGCAAGCACGTCCTC
GATGATCGCGGCCTCGTAAAATGGTGGTGTCGCATCCTGGATCAGTTGCTCGTCTCGCCACATTCGGGCGCTTCA
GCGCCGTCATGGAAGAATGTTCAAGGCTATCTAGTCGTGCCCGGGCTCGAGGCTGTCGAAACCAGGGCGTTGATC
CCTAGATACTCCGCCCAATCCTCGTCATGGATCCTGGGCCATCCTCTTGAGCGCATTTCTCACTACAGTCGCGAG
TTCGACTGGGTACCCCCACGGTGCCTGATTCCTCGATTTCCCGATGACCCTAAATCTCGATTCCGTGATGAACTC
GACGAGGAGGCATCCAATTCCGGCTCAATGCAGAACATGGGCACCTGGAGAAGTGTCAAGTCCCTCGACATGTTC
TGGGAAGTCATGGGGTTCCGTCAGGAGTGCTCGAGCGGTAGGATGACGGGTTTCATCTGGGTCGTGTTCGATGAC
GAGGACAGCTTACAGCGCGCCAAGTCTGAGCTCGATCCTCCAGTTCCGTCTACGCCGACGCGAAAGAAGGCGGCG
CCCGAAGTCACACCAAAGACAACTCCGAAAAAGCTCGTCCATTTACAGGGAGAAACTGCCGGCACAGAGCTTATC
GAATCATGCCGAGGCAAAAAGGTCGGGAAGACAAAGGTCCACAAAAAGACACTACGAGGTAGCATCAAGGCCCGG
CAGCCTCGAGTCAAAAACGTGCAACGAAACTACTTGACGGACAGGCCTGTGTCGAGCAAGTACTACTTTTGGCCG
GCGCCAGGGAGAGGCGAGAGGTTAGTCGATAAAGGTGACTACAAACGAATCGTGGAGCTATTGCTCCACCTTGAT
TTCGCGACCCTGGACAAGGCCACCGGCAGCTCCAAGCGCTGGATCGCCGAGGCTGGCATGGGCATGCTTTGGGGC
TTCGAGGTGACAGGAACCAAGGGACCGCCTCTACACTCCGAGAGTGAGCAAGGCGGCCACAGACCCGTCCACGTC
AATAACCTCTCTGGGTTTGTCAAGAGAAAGAGGGCCGACGCGGCCGACCACGAGTCACGGTTGGCGCTAGAGCAG
GACAGCAGCATGGGCACCAGGTGTCTGATAGAAGATGAGACACAACGTGATGTGCAGACGGAGCTGGTGACCAAA
AAGCCAAAGACGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail