Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5929
Gene name
LocationContig_3:66388..68534
Strand+
Gene length (bp)2146
Transcript length (bp)1659
Coding sequence length (bp)1659
Protein length (aa) 553

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00514 Arm Armadillo/beta-catenin-like repeat 1.2E-08 117 156
PF00514 Arm Armadillo/beta-catenin-like repeat 2.4E-07 159 197
PF00514 Arm Armadillo/beta-catenin-like repeat 4.4E-13 199 238
PF00514 Arm Armadillo/beta-catenin-like repeat 6.4E-06 252 282
PF00514 Arm Armadillo/beta-catenin-like repeat 1.5E-07 327 365
PF00514 Arm Armadillo/beta-catenin-like repeat 1.9E-06 408 448
PF04826 Arm_2 Armadillo-like 5.9E-07 92 268
PF03224 V-ATPase_H_N V-ATPase subunit H 1.8E-05 204 386
PF05804 KAP Kinesin-associated protein (KAP) 1.0E-07 105 367

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=VAC8 PE=3 SV=4 1 549 0.0E+00
sp|Q7RXW1|VAC8_NEUCR Vacuolar protein 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vac8 PE=3 SV=4 1 552 0.0E+00
sp|Q2GW27|VAC8_CHAGB Vacuolar protein 8 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VAC8 PE=3 SV=3 1 549 0.0E+00
sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vac8 PE=3 SV=1 4 548 0.0E+00
sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=vac8 PE=3 SV=1 4 548 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=VAC8 PE=3 SV=4 1 549 0.0E+00
sp|Q7RXW1|VAC8_NEUCR Vacuolar protein 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vac8 PE=3 SV=4 1 552 0.0E+00
sp|Q2GW27|VAC8_CHAGB Vacuolar protein 8 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VAC8 PE=3 SV=3 1 549 0.0E+00
sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vac8 PE=3 SV=1 4 548 0.0E+00
sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=vac8 PE=3 SV=1 4 548 0.0E+00
sp|P0CM60|VAC8_CRYNJ Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VAC8 PE=3 SV=1 1 546 0.0E+00
sp|P0CM61|VAC8_CRYNB Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VAC8 PE=3 SV=1 1 546 0.0E+00
sp|Q6C5Y8|VAC8_YARLI Vacuolar protein 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VAC8 PE=3 SV=1 11 547 0.0E+00
sp|O43028|VAC8_SCHPO Vacuolar protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vac8 PE=1 SV=4 1 549 0.0E+00
sp|Q6BTZ4|VAC8_DEBHA Vacuolar protein 8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VAC8 PE=3 SV=4 1 548 0.0E+00
sp|Q59MN0|VAC8_CANAL Vacuolar protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VAC8 PE=3 SV=3 1 548 0.0E+00
sp|Q5EFZ4|VAC8_PICPA Vacuolar protein 8 OS=Komagataella pastoris GN=VAC8 PE=3 SV=3 1 547 0.0E+00
sp|Q757R0|VAC8_ASHGO Vacuolar protein 8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VAC8 PE=3 SV=3 1 524 0.0E+00
sp|P39968|VAC8_YEAST Vacuolar protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAC8 PE=1 SV=3 1 524 0.0E+00
sp|Q6FJV1|VAC8_CANGA Vacuolar protein 8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VAC8 PE=3 SV=3 1 520 0.0E+00
sp|Q6CX49|VAC8_KLULA Vacuolar protein 8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VAC8 PE=3 SV=3 1 532 0.0E+00
sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 91 299 2.0E-18
sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana GN=ARIA PE=1 SV=2 102 382 3.0E-18
sp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 2 OS=Arabidopsis thaliana GN=PUB2 PE=2 SV=1 96 346 9.0E-17
sp|Q8GUG9|PUB11_ARATH U-box domain-containing protein 11 OS=Arabidopsis thaliana GN=PUB11 PE=2 SV=2 85 305 3.0E-16
sp|O22193|PUB4_ARATH U-box domain-containing protein 4 OS=Arabidopsis thaliana GN=PUB4 PE=1 SV=3 95 309 2.0E-14
sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 102 459 3.0E-14
sp|Q8GWV5|PUB3_ARATH U-box domain-containing protein 3 OS=Arabidopsis thaliana GN=PUB3 PE=2 SV=2 60 300 4.0E-14
sp|B2RY50|ARMC4_MOUSE Armadillo repeat-containing protein 4 OS=Mus musculus GN=Armc4 PE=1 SV=1 85 443 1.0E-13
sp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 2 OS=Arabidopsis thaliana GN=PUB2 PE=2 SV=1 95 305 2.0E-13
sp|Q5T2S8|ARMC4_HUMAN Armadillo repeat-containing protein 4 OS=Homo sapiens GN=ARMC4 PE=1 SV=1 85 443 3.0E-13
sp|P30998|PLAK_XENLA Junction plakoglobin OS=Xenopus laevis GN=jup PE=2 SV=1 87 358 3.0E-12
sp|Q5VRH9|PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza sativa subsp. japonica GN=PUB12 PE=2 SV=1 96 305 6.0E-12
sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 82 306 8.0E-12
sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=1 SV=1 91 302 1.0E-11
sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 182 498 2.0E-11
sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana GN=ARIA PE=1 SV=2 182 498 2.0E-11
sp|Q02821|IMA1_YEAST Importin subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP1 PE=1 SV=1 45 358 3.0E-11
sp|Q681N2|PUB15_ARATH U-box domain-containing protein 15 OS=Arabidopsis thaliana GN=PUB15 PE=2 SV=2 201 339 4.0E-11
sp|Q5W041|ARMC3_HUMAN Armadillo repeat-containing protein 3 OS=Homo sapiens GN=ARMC3 PE=2 SV=2 78 368 5.0E-11
sp|Q9FWY7|IMPA6_ARATH Importin subunit alpha-6 OS=Arabidopsis thaliana GN=IMPA6 PE=2 SV=1 49 375 8.0E-11
sp|Q9ZV31|PUB12_ARATH U-box domain-containing protein 12 OS=Arabidopsis thaliana GN=PUB12 PE=2 SV=1 91 300 8.0E-11
sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=1 SV=1 141 351 1.0E-10
sp|O94374|IMA2_SCHPO Importin subunit alpha-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp1 PE=1 SV=1 126 380 2.0E-10
sp|Q681N2|PUB15_ARATH U-box domain-containing protein 15 OS=Arabidopsis thaliana GN=PUB15 PE=2 SV=2 38 244 6.0E-10
sp|Q0IMG9|SL11_ORYSJ E3 ubiquitin-protein ligase SPL11 OS=Oryza sativa subsp. japonica GN=SPL11 PE=1 SV=2 103 293 6.0E-10
sp|A2ZLU6|SL11_ORYSI Protein spotted leaf 11 OS=Oryza sativa subsp. indica GN=SPL11 PE=1 SV=2 103 293 6.0E-10
sp|Q5W041|ARMC3_HUMAN Armadillo repeat-containing protein 3 OS=Homo sapiens GN=ARMC3 PE=2 SV=2 51 283 8.0E-10
sp|O94374|IMA2_SCHPO Importin subunit alpha-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp1 PE=1 SV=1 54 358 9.0E-10
sp|Q17GS9|ARM_AEDAE Armadillo segment polarity protein OS=Aedes aegypti GN=arm PE=3 SV=1 177 373 1.0E-09
sp|P18824|ARM_DROME Armadillo segment polarity protein OS=Drosophila melanogaster GN=arm PE=1 SV=1 177 432 1.0E-09
sp|Q29I35|ARM_DROPS Armadillo segment polarity protein OS=Drosophila pseudoobscura pseudoobscura GN=arm PE=3 SV=2 177 432 1.0E-09
sp|Q7QHW5|ARM_ANOGA Armadillo segment polarity protein OS=Anopheles gambiae GN=arm PE=3 SV=5 177 373 1.0E-09
sp|Q9FJ09|IMPA5_ARATH Importin subunit alpha-5 OS=Arabidopsis thaliana GN=IMPA5 PE=2 SV=1 45 392 3.0E-09
sp|P52293|IMA1_MOUSE Importin subunit alpha-1 OS=Mus musculus GN=Kpna2 PE=1 SV=2 139 448 3.0E-09
sp|Q9C9A6|PUB10_ARATH U-box domain-containing protein 10 OS=Arabidopsis thaliana GN=PUB10 PE=2 SV=1 51 302 4.0E-09
sp|Q6P0K8|PLAK_RAT Junction plakoglobin OS=Rattus norvegicus GN=Jup PE=1 SV=1 87 344 6.0E-09
sp|Q9STT1|PUB39_ARATH U-box domain-containing protein 39 OS=Arabidopsis thaliana GN=PUB39 PE=2 SV=1 103 221 7.0E-09
sp|O22478|IMA_SOLLC Importin subunit alpha OS=Solanum lycopersicum PE=2 SV=2 49 394 8.0E-09
sp|P52292|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens GN=KPNA2 PE=1 SV=1 139 448 8.0E-09
sp|Q0WUF6|PUB41_ARATH U-box domain-containing protein 41 OS=Arabidopsis thaliana GN=PUB41 PE=2 SV=1 103 223 8.0E-09
sp|P30998|PLAK_XENLA Junction plakoglobin OS=Xenopus laevis GN=jup PE=2 SV=1 177 388 9.0E-09
sp|P35223|CTNB_TRIGR Catenin beta OS=Tripneustes gratilla PE=2 SV=1 177 364 9.0E-09
sp|Q6P0K8|PLAK_RAT Junction plakoglobin OS=Rattus norvegicus GN=Jup PE=1 SV=1 177 373 1.0E-08
sp|P14923|PLAK_HUMAN Junction plakoglobin OS=Homo sapiens GN=JUP PE=1 SV=3 177 373 1.0E-08
sp|Q8SPJ1|PLAK_BOVIN Junction plakoglobin OS=Bos taurus GN=JUP PE=2 SV=1 177 373 1.0E-08
sp|O22161|ADLO1_ARATH Protein ARABIDILLO 1 OS=Arabidopsis thaliana GN=FBX5 PE=1 SV=1 89 221 1.0E-08
sp|A2AU72|ARMC3_MOUSE Armadillo repeat-containing protein 3 OS=Mus musculus GN=Armc3 PE=1 SV=1 159 382 1.0E-08
sp|P35224|CTNB_URECA Catenin beta OS=Urechis caupo PE=2 SV=1 117 368 1.0E-08
sp|Q8WNW3|PLAK_PIG Junction plakoglobin OS=Sus scrofa GN=Jup PE=2 SV=1 177 373 1.0E-08
sp|Q8WNW3|PLAK_PIG Junction plakoglobin OS=Sus scrofa GN=Jup PE=2 SV=1 87 344 1.0E-08
sp|Q02257|PLAK_MOUSE Junction plakoglobin OS=Mus musculus GN=Jup PE=1 SV=3 177 373 1.0E-08
sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=1 SV=1 87 246 2.0E-08
sp|P14923|PLAK_HUMAN Junction plakoglobin OS=Homo sapiens GN=JUP PE=1 SV=3 87 344 2.0E-08
sp|Q8SPJ1|PLAK_BOVIN Junction plakoglobin OS=Bos taurus GN=JUP PE=2 SV=1 87 344 2.0E-08
sp|Q02453|ARM_MUSDO Armadillo segment polarity protein OS=Musca domestica GN=arm PE=2 SV=1 144 432 2.0E-08
sp|Q9FJP6|PUB38_ARATH U-box domain-containing protein 38 OS=Arabidopsis thaliana GN=PUB38 PE=1 SV=1 103 275 2.0E-08
sp|O04294|IMPA3_ARATH Importin subunit alpha-3 OS=Arabidopsis thaliana GN=IMPA3 PE=1 SV=2 92 350 2.0E-08
sp|Q5T2S8|ARMC4_HUMAN Armadillo repeat-containing protein 4 OS=Homo sapiens GN=ARMC4 PE=1 SV=1 60 348 3.0E-08
sp|P18824|ARM_DROME Armadillo segment polarity protein OS=Drosophila melanogaster GN=arm PE=1 SV=1 117 344 3.0E-08
sp|Q29I35|ARM_DROPS Armadillo segment polarity protein OS=Drosophila pseudoobscura pseudoobscura GN=arm PE=3 SV=2 117 344 3.0E-08
sp|Q02257|PLAK_MOUSE Junction plakoglobin OS=Mus musculus GN=Jup PE=1 SV=3 87 344 3.0E-08
sp|A2RT91|ANKAR_MOUSE Ankyrin and armadillo repeat-containing protein OS=Mus musculus GN=Ankar PE=2 SV=1 199 449 3.0E-08
sp|Q02453|ARM_MUSDO Armadillo segment polarity protein OS=Musca domestica GN=arm PE=2 SV=1 117 344 4.0E-08
sp|Q54I71|AARA_DICDI Protein aardvark OS=Dictyostelium discoideum GN=aarA PE=2 SV=1 103 296 4.0E-08
sp|Q9ZV31|PUB12_ARATH U-box domain-containing protein 12 OS=Arabidopsis thaliana GN=PUB12 PE=2 SV=1 85 351 5.0E-08
sp|O04294|IMPA3_ARATH Importin subunit alpha-3 OS=Arabidopsis thaliana GN=IMPA3 PE=1 SV=2 137 448 5.0E-08
sp|O22193|PUB4_ARATH U-box domain-containing protein 4 OS=Arabidopsis thaliana GN=PUB4 PE=1 SV=3 167 453 6.0E-08
sp|Q54I71|AARA_DICDI Protein aardvark OS=Dictyostelium discoideum GN=aarA PE=2 SV=1 101 250 6.0E-08
sp|Q503E9|IMA6_DANRE Importin subunit alpha-6 OS=Danio rerio GN=kpna5 PE=2 SV=2 60 363 6.0E-08
sp|B2RY50|ARMC4_MOUSE Armadillo repeat-containing protein 4 OS=Mus musculus GN=Armc4 PE=1 SV=1 60 348 8.0E-08
sp|P26233|CTNB_XENLA Catenin beta OS=Xenopus laevis GN=ctnnb1 PE=1 SV=1 89 344 8.0E-08
sp|B2RY50|ARMC4_MOUSE Armadillo repeat-containing protein 4 OS=Mus musculus GN=Armc4 PE=1 SV=1 54 237 9.0E-08
sp|Q9WU82|CTNB1_RAT Catenin beta-1 OS=Rattus norvegicus GN=Ctnnb1 PE=1 SV=1 89 344 9.0E-08
sp|F4JL11|IMPA2_ARATH Importin subunit alpha-2 OS=Arabidopsis thaliana GN=IMPA2 PE=1 SV=1 49 391 9.0E-08
sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana GN=ARIA PE=1 SV=2 89 284 1.0E-07
sp|Q5T2S8|ARMC4_HUMAN Armadillo repeat-containing protein 4 OS=Homo sapiens GN=ARMC4 PE=1 SV=1 54 237 1.0E-07
sp|O94374|IMA2_SCHPO Importin subunit alpha-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp1 PE=1 SV=1 84 376 1.0E-07
sp|P35224|CTNB_URECA Catenin beta OS=Urechis caupo PE=2 SV=1 177 370 1.0E-07
sp|B6V8E6|CTNB1_CANLF Catenin beta-1 OS=Canis lupus familiaris GN=CTNNB1 PE=1 SV=1 89 344 1.0E-07
sp|Q0VCX4|CTNB1_BOVIN Catenin beta-1 OS=Bos taurus GN=CTNNB1 PE=1 SV=1 89 344 1.0E-07
sp|Q02248|CTNB1_MOUSE Catenin beta-1 OS=Mus musculus GN=Ctnnb1 PE=1 SV=1 89 344 1.0E-07
sp|P35222|CTNB1_HUMAN Catenin beta-1 OS=Homo sapiens GN=CTNNB1 PE=1 SV=1 89 344 1.0E-07
sp|A9QM74|IMA8_HUMAN Importin subunit alpha-8 OS=Homo sapiens GN=KPNA7 PE=1 SV=1 84 348 1.0E-07
sp|Q02821|IMA1_YEAST Importin subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP1 PE=1 SV=1 130 448 2.0E-07
sp|A2AU72|ARMC3_MOUSE Armadillo repeat-containing protein 3 OS=Mus musculus GN=Armc3 PE=1 SV=1 51 225 2.0E-07
sp|P26233|CTNB_XENLA Catenin beta OS=Xenopus laevis GN=ctnnb1 PE=1 SV=1 152 373 2.0E-07
sp|Q9WU82|CTNB1_RAT Catenin beta-1 OS=Rattus norvegicus GN=Ctnnb1 PE=1 SV=1 152 373 2.0E-07
sp|Q9FL17|PUB40_ARATH U-box domain-containing protein 40 OS=Arabidopsis thaliana GN=PUB40 PE=2 SV=2 95 220 2.0E-07
sp|Q96321|IMPA1_ARATH Importin subunit alpha-1 OS=Arabidopsis thaliana GN=IMPA1 PE=1 SV=2 46 391 2.0E-07
sp|Q9C9A6|PUB10_ARATH U-box domain-containing protein 10 OS=Arabidopsis thaliana GN=PUB10 PE=2 SV=1 180 427 3.0E-07
sp|B6V8E6|CTNB1_CANLF Catenin beta-1 OS=Canis lupus familiaris GN=CTNNB1 PE=1 SV=1 152 388 3.0E-07
sp|Q0VCX4|CTNB1_BOVIN Catenin beta-1 OS=Bos taurus GN=CTNNB1 PE=1 SV=1 152 388 3.0E-07
sp|Q02248|CTNB1_MOUSE Catenin beta-1 OS=Mus musculus GN=Ctnnb1 PE=1 SV=1 152 388 3.0E-07
sp|P35222|CTNB1_HUMAN Catenin beta-1 OS=Homo sapiens GN=CTNNB1 PE=1 SV=1 152 388 3.0E-07
sp|Q9M224|ADLO2_ARATH Protein ARABIDILLO 2 OS=Arabidopsis thaliana GN=At3g60350 PE=2 SV=1 89 221 3.0E-07
sp|C6K7I2|IMA8_PIG Importin subunit alpha-8 OS=Sus scrofa GN=KPNA7 PE=2 SV=2 189 490 3.0E-07
sp|C1JZ66|IMA8_BOVIN Importin subunit alpha-8 OS=Bos taurus GN=KPNA7 PE=1 SV=2 89 352 3.0E-07
sp|Q0WUF6|PUB41_ARATH U-box domain-containing protein 41 OS=Arabidopsis thaliana GN=PUB41 PE=2 SV=1 174 379 4.0E-07
sp|C6K7I2|IMA8_PIG Importin subunit alpha-8 OS=Sus scrofa GN=KPNA7 PE=2 SV=2 84 352 4.0E-07
sp|Q76P29|IMAB_DICDI Importin subunit alpha-B OS=Dictyostelium discoideum GN=DDB_G0272318 PE=3 SV=1 84 348 4.0E-07
sp|Q8VZ40|PUB14_ARATH U-box domain-containing protein 14 OS=Arabidopsis thaliana GN=PUB14 PE=1 SV=1 91 295 4.0E-07
sp|Q9SV36|ARK1_ARATH Armadillo repeat-containing kinesin-like protein 1 OS=Arabidopsis thaliana GN=ARK1 PE=1 SV=2 89 302 4.0E-07
sp|Q8VZ40|PUB14_ARATH U-box domain-containing protein 14 OS=Arabidopsis thaliana GN=PUB14 PE=1 SV=1 167 344 5.0E-07
sp|O35345|IMA7_MOUSE Importin subunit alpha-7 OS=Mus musculus GN=Kpna6 PE=1 SV=2 60 363 5.0E-07
sp|C0LLJ0|IMA8_MOUSE Importin subunit alpha-8 OS=Mus musculus GN=Kpna7 PE=1 SV=1 65 350 5.0E-07
sp|Q71VM4|IMA1A_ORYSJ Importin subunit alpha-1a OS=Oryza sativa subsp. japonica GN=Os01g0253300 PE=1 SV=2 84 387 6.0E-07
sp|O44326|HMP2_CAEEL Beta-catenin-like protein hmp-2 OS=Caenorhabditis elegans GN=hmp-2 PE=1 SV=1 178 373 6.0E-07
sp|Q5VQ09|ARK2_ORYSJ Armadillo repeat-containing kinesin-like protein 2 OS=Oryza sativa subsp. japonica GN=Os06g0137100 PE=2 SV=1 89 302 6.0E-07
sp|O80480|IMPA4_ARATH Importin subunit alpha-4 OS=Arabidopsis thaliana GN=IMPA4 PE=1 SV=1 91 378 7.0E-07
sp|A2AU72|ARMC3_MOUSE Armadillo repeat-containing protein 3 OS=Mus musculus GN=Armc3 PE=1 SV=1 78 360 8.0E-07
sp|Q0V7M0|IMA7_BOVIN Importin subunit alpha-7 OS=Bos taurus GN=KPNA6 PE=2 SV=1 60 363 1.0E-06
sp|P35223|CTNB_TRIGR Catenin beta OS=Tripneustes gratilla PE=2 SV=1 117 344 2.0E-06
sp|Q54I71|AARA_DICDI Protein aardvark OS=Dictyostelium discoideum GN=aarA PE=2 SV=1 159 415 2.0E-06
sp|Q76P29|IMAB_DICDI Importin subunit alpha-B OS=Dictyostelium discoideum GN=DDB_G0272318 PE=3 SV=1 164 448 2.0E-06
sp|O14063|IMA1_SCHPO Importin subunit alpha-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut15 PE=1 SV=1 37 353 2.0E-06
sp|Q04173|GDS1_BOVIN Rap1 GTPase-GDP dissociation stimulator 1 OS=Bos taurus GN=RAP1GDS1 PE=1 SV=1 51 363 2.0E-06
sp|Q5RBV0|IMA7_PONAB Importin subunit alpha-7 OS=Pongo abelii GN=KPNA6 PE=2 SV=1 60 363 2.0E-06
sp|O60684|IMA7_HUMAN Importin subunit alpha-7 OS=Homo sapiens GN=KPNA6 PE=1 SV=1 60 363 2.0E-06
sp|Q02821|IMA1_YEAST Importin subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP1 PE=1 SV=1 84 379 3.0E-06
sp|Q0V7M0|IMA7_BOVIN Importin subunit alpha-7 OS=Bos taurus GN=KPNA6 PE=2 SV=1 177 448 3.0E-06
sp|Q0DV28|ARK1_ORYSJ Armadillo repeat-containing kinesin-like protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0152900 PE=2 SV=2 92 330 3.0E-06
sp|O22478|IMA_SOLLC Importin subunit alpha OS=Solanum lycopersicum PE=2 SV=2 177 448 4.0E-06
sp|Q9FJ09|IMPA5_ARATH Importin subunit alpha-5 OS=Arabidopsis thaliana GN=IMPA5 PE=2 SV=1 165 403 5.0E-06
sp|Q0IMG9|SL11_ORYSJ E3 ubiquitin-protein ligase SPL11 OS=Oryza sativa subsp. japonica GN=SPL11 PE=1 SV=2 133 346 6.0E-06
sp|A2ZLU6|SL11_ORYSI Protein spotted leaf 11 OS=Oryza sativa subsp. indica GN=SPL11 PE=1 SV=2 133 346 6.0E-06
sp|Q503E9|IMA6_DANRE Importin subunit alpha-6 OS=Danio rerio GN=kpna5 PE=2 SV=2 47 537 8.0E-06
sp|Q9XIJ5|PUB18_ARATH U-box domain-containing protein 18 OS=Arabidopsis thaliana GN=PUB18 PE=2 SV=1 95 306 8.0E-06
sp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 2 OS=Arabidopsis thaliana GN=PUB2 PE=2 SV=1 255 493 9.0E-06
sp|Q0WUF6|PUB41_ARATH U-box domain-containing protein 41 OS=Arabidopsis thaliana GN=PUB41 PE=2 SV=1 144 266 9.0E-06
sp|P52292|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens GN=KPNA2 PE=1 SV=1 146 321 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0046961 proton-transporting ATPase activity, rotational mechanism Yes
GO:0000221 vacuolar proton-transporting V-type ATPase, V1 domain Yes
GO:0015991 ATP hydrolysis coupled proton transport Yes
GO:0006810 transport No
GO:0005215 transporter activity No
GO:0015988 energy coupled proton transmembrane transport, against electrochemical gradient No
GO:0015405 P-P-bond-hydrolysis-driven transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0044437 vacuolar part No
GO:0043492 ATPase activity, coupled to movement of substances No
GO:0042623 ATPase activity, coupled No
GO:0006811 ion transport No
GO:0099131 ATP hydrolysis coupled ion transmembrane transport No
GO:0036442 proton-exporting ATPase activity No
GO:0098660 inorganic ion transmembrane transport No
GO:0044425 membrane part No
GO:0016887 ATPase activity No
GO:0044769 ATPase activity, coupled to transmembrane movement of ions, rotational mechanism No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0044422 organelle part No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0019829 cation-transporting ATPase activity No
GO:0098662 inorganic cation transmembrane transport No
GO:0033180 proton-transporting V-type ATPase, V1 domain No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0098796 membrane protein complex No
GO:0022853 active ion transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0022804 active transmembrane transporter activity No
GO:0044446 intracellular organelle part No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015399 primary active transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0099132 ATP hydrolysis coupled cation transmembrane transport No
GO:0033178 proton-transporting two-sector ATPase complex, catalytic domain No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0051234 establishment of localization No
GO:0003824 catalytic activity No
GO:0098655 cation transmembrane transport No
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0034220 ion transmembrane transport No
GO:0090662 ATP hydrolysis coupled transmembrane transport No
GO:0015077 monovalent inorganic cation transmembrane transporter activity No
GO:0042625 ATPase coupled ion transmembrane transporter activity No
GO:0017111 nucleoside-triphosphatase activity No
GO:0015672 monovalent inorganic cation transport No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0042626 ATPase activity, coupled to transmembrane movement of substances No
GO:0015078 proton transmembrane transporter activity No
GO:0006812 cation transport No
GO:1902600 proton transmembrane transport No
GO:0055085 transmembrane transport No
GO:0051179 localization No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0008324 cation transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5929
MGICHSTCCGGRARDGLYEPVLADSEREAVADLLQYLENRGETDFFSGEPLQALSTLVFSENIDLQRSASLTFAE
ITERDVREVDRDTLHPILFLLNSQDIEVQRAASAALGNLAVNTENKVLIVQMGGLTPLTRQMLSTNVEVQCNAVG
CITNLATHEENKAKIARSGALGPLTRLAKSRDMRVQRNATGALLNMTHSDENRQQLVNANAIPVLVQLLSSPDVD
VQYYCTTALSNIAVDANNRRKLASSEPKLVQSLVNLMDSSSPKVQCQAALALRNLASDEKYQLDIVRANGLHPLL
RLLQSSYLPLILSAVACIRNISIHPMNESPIIEANFLKPLVDLLGSTDNEEIQCHAISTLRNLAASSDRNKALVL
DAGAVQKCKQLVLDVPVTVQSEMTAAIAVLALSDDLKSHLLNLGVCDVLIPLTHSPSIEVQGNSAAALGNLSSKV
GDYSIFVQNWTEPGGGIHGYLGRFLQSGDATFQHIAVWTLLQLFESEDKTLIGLIGKADDIIEHIRNIANRQVET
EPDFEEDEGEVVNLAQRCLELLGQMNA*
Coding >Hirsu2|5929
ATGGGGATTTGCCACTCGACATGCTGTGGCGGACGAGCCCGCGATGGCCTTTATGAACCCGTCCTGGCCGACAGC
GAGCGGGAAGCCGTCGCCGACCTGCTCCAGTACCTTGAGAATCGCGGCGAGACCGACTTCTTTTCCGGCGAACCT
CTCCAAGCCTTGAGCACTCTGGTCTTTTCCGAGAACATCGACCTCCAACGCAGCGCAAGCTTGACATTTGCCGAG
ATCACAGAGAGAGATGTCCGAGAAGTCGACCGCGATACCCTCCATCCGATTCTTTTTCTCCTGAACAGCCAAGAT
ATTGAGGTCCAAAGAGCAGCCAGCGCCGCGCTCGGCAACCTTGCTGTCAACACCGAGAACAAGGTTCTCATTGTC
CAGATGGGTGGTCTGACCCCGCTGACCCGCCAGATGCTCTCCACGAATGTCGAGGTGCAATGCAACGCTGTCGGG
TGCATCACCAACTTGGCCACCCACGAGGAGAACAAGGCCAAGATTGCGCGGTCCGGAGCCCTCGGCCCCTTGACC
CGGTTGGCAAAGTCGAGAGATATGCGCGTACAGAGAAACGCCACGGGCGCCCTCCTCAACATGACACATTCCGAC
GAGAACAGGCAACAGCTCGTTAACGCCAACGCGATCCCGGTTCTTGTCCAGCTCCTCTCCTCTCCCGACGTCGAC
GTGCAGTACTACTGCACGACGGCCCTCAGCAACATCGCAGTCGACGCCAACAATAGACGGAAGCTGGCCTCGTCG
GAGCCCAAGCTGGTTCAGTCCCTCGTCAACCTGATGGACTCGTCCTCGCCCAAGGTTCAATGCCAGGCCGCCTTG
GCCCTGCGAAACCTGGCATCCGACGAGAAATACCAGCTCGACATTGTGCGGGCCAACGGCCTCCACCCCCTCCTC
CGCCTTCTCCAGTCGTCCTATCTTCCCCTCATTCTCTCGGCCGTCGCCTGCATACGAAACATCTCCATCCACCCC
ATGAATGAGTCGCCCATTATCGAGGCCAACTTCCTGAAGCCCTTGGTTGACCTCCTCGGATCGACAGACAACGAG
GAGATCCAGTGCCATGCCATTTCCACTCTGCGCAACCTGGCCGCCAGCTCCGACCGGAACAAGGCGCTCGTGCTG
GACGCGGGGGCCGTGCAAAAGTGCAAGCAATTGGTGCTCGACGTCCCCGTCACTGTCCAGTCGGAAATGACGGCG
GCCATCGCGGTCCTTGCACTGAGCGACGACCTCAAGTCGCATCTCCTCAACCTGGGTGTCTGCGATGTTCTCATC
CCTCTGACCCACTCACCCAGCATCGAGGTCCAGGGCAACAGCGCCGCCGCCCTGGGCAACCTCTCATCCAAAGTC
GGCGACTACTCTATCTTTGTGCAAAATTGGACCGAGCCCGGCGGCGGCATCCACGGCTACCTCGGACGCTTCCTG
CAATCTGGCGACGCCACCTTTCAGCACATTGCCGTCTGGACGCTGCTTCAGCTTTTCGAATCCGAAGACAAGACG
TTGATCGGACTCATCGGCAAGGCCGACGACATTATCGAGCACATCCGGAACATTGCGAACCGGCAGGTGGAGACG
GAGCCAGACTTTGAAGAGGACGAGGGCGAAGTGGTCAATCTGGCGCAGCGGTGCCTCGAGCTTTTGGGACAGATG
AACGCCTGA
Transcript >Hirsu2|5929
ATGGGGATTTGCCACTCGACATGCTGTGGCGGACGAGCCCGCGATGGCCTTTATGAACCCGTCCTGGCCGACAGC
GAGCGGGAAGCCGTCGCCGACCTGCTCCAGTACCTTGAGAATCGCGGCGAGACCGACTTCTTTTCCGGCGAACCT
CTCCAAGCCTTGAGCACTCTGGTCTTTTCCGAGAACATCGACCTCCAACGCAGCGCAAGCTTGACATTTGCCGAG
ATCACAGAGAGAGATGTCCGAGAAGTCGACCGCGATACCCTCCATCCGATTCTTTTTCTCCTGAACAGCCAAGAT
ATTGAGGTCCAAAGAGCAGCCAGCGCCGCGCTCGGCAACCTTGCTGTCAACACCGAGAACAAGGTTCTCATTGTC
CAGATGGGTGGTCTGACCCCGCTGACCCGCCAGATGCTCTCCACGAATGTCGAGGTGCAATGCAACGCTGTCGGG
TGCATCACCAACTTGGCCACCCACGAGGAGAACAAGGCCAAGATTGCGCGGTCCGGAGCCCTCGGCCCCTTGACC
CGGTTGGCAAAGTCGAGAGATATGCGCGTACAGAGAAACGCCACGGGCGCCCTCCTCAACATGACACATTCCGAC
GAGAACAGGCAACAGCTCGTTAACGCCAACGCGATCCCGGTTCTTGTCCAGCTCCTCTCCTCTCCCGACGTCGAC
GTGCAGTACTACTGCACGACGGCCCTCAGCAACATCGCAGTCGACGCCAACAATAGACGGAAGCTGGCCTCGTCG
GAGCCCAAGCTGGTTCAGTCCCTCGTCAACCTGATGGACTCGTCCTCGCCCAAGGTTCAATGCCAGGCCGCCTTG
GCCCTGCGAAACCTGGCATCCGACGAGAAATACCAGCTCGACATTGTGCGGGCCAACGGCCTCCACCCCCTCCTC
CGCCTTCTCCAGTCGTCCTATCTTCCCCTCATTCTCTCGGCCGTCGCCTGCATACGAAACATCTCCATCCACCCC
ATGAATGAGTCGCCCATTATCGAGGCCAACTTCCTGAAGCCCTTGGTTGACCTCCTCGGATCGACAGACAACGAG
GAGATCCAGTGCCATGCCATTTCCACTCTGCGCAACCTGGCCGCCAGCTCCGACCGGAACAAGGCGCTCGTGCTG
GACGCGGGGGCCGTGCAAAAGTGCAAGCAATTGGTGCTCGACGTCCCCGTCACTGTCCAGTCGGAAATGACGGCG
GCCATCGCGGTCCTTGCACTGAGCGACGACCTCAAGTCGCATCTCCTCAACCTGGGTGTCTGCGATGTTCTCATC
CCTCTGACCCACTCACCCAGCATCGAGGTCCAGGGCAACAGCGCCGCCGCCCTGGGCAACCTCTCATCCAAAGTC
GGCGACTACTCTATCTTTGTGCAAAATTGGACCGAGCCCGGCGGCGGCATCCACGGCTACCTCGGACGCTTCCTG
CAATCTGGCGACGCCACCTTTCAGCACATTGCCGTCTGGACGCTGCTTCAGCTTTTCGAATCCGAAGACAAGACG
TTGATCGGACTCATCGGCAAGGCCGACGACATTATCGAGCACATCCGGAACATTGCGAACCGGCAGGTGGAGACG
GAGCCAGACTTTGAAGAGGACGAGGGCGAAGTGGTCAATCTGGCGCAGCGGTGCCTCGAGCTTTTGGGACAGATG
AACGCCTGA
Gene >Hirsu2|5929
ATGGGGATTTGCCACTCGACATGCTGTGGCGGTAAATCTTGCCCCGACGCGTCACTCCATTCGCTCGTCTTTGTT
GTTGTTATTGACGGCTGTTCCCAGGACGAGCCCGCGATGGCCTTTATGAACCCGTCCTGGCCGACAGCGAGCGGG
AAGCCGTCGCCGACCTGCTCCAGTACCTTGAGAATGTCGTCATCCCCTACCGTGCGTGCCTTGCCTTGATCCGAC
CCGGAGCTGACCTTGGCACAGCGCGGCGAGACCGACTTCTTTTCCGGCGAACCTCTCCAAGCCTTGAGCACTCTG
GTCTTTTCCGAGAACATCGACCTCCAACGCAGCGCAAGCTTGACATTTGCCGAGATCACAGAGAGAGGTATGTGC
TTACACCGCCGCGAGTATCCGATCGGCCCGGTGTTTGCCCACTTCGCGCCGTGTGCTCCCACGTCATCGTCTTCG
GCCACGATGCTGACACGAGACCATCAGATGTCCGAGAAGTCGACCGCGATACCCTCCATCCGATTCTTTTTCTCC
TGAACAGCCAAGATATTGAGGTCCAAAGAGCAGCCAGCGCCGCGCTCGGCAACCTTGCTGTCAACAGTAAACACT
CCACGCCCTGCGAAAACGCCGAATGAACGCTGACGTGCACGCCGCAGCCGAGAACAAGGTTCTCATTGTCCAGAT
GGGTGGTCTGACCCCGCTGACCCGCCAGATGCTCTCCACGAATGTCGAGGTGCAATGCAACGCTGTCGGGTGCAT
CACCAACTTGGCCACCCACGAGGAGAACAAGGCCAAGATTGCGCGGTCCGGAGCCCTCGGCCCCTTGACCCGGTT
GGCAAAGTCGAGAGATATGCGCGTACAGAGAAACGCCACGGGCGCCCTCCTCAACATGACACATTCCGGTAAGCC
GCCGTCCGCCTCGAGTCTCTCGAGCCTCGCTCACTCATGACCGCCCCGCAGACGAGAACAGGCAACAGCTCGTTA
ACGCCAACGCGATCCCGGTTCTTGTCCAGCTCCTCTCCTCTCCCGACGTCGACGTGCAGTACTACTGCACGACGG
CCCTCAGCAACATCGCAGTCGACGCCAACAATAGACGGAAGCTGGCCTCGTCGGAGCCCAAGCTGGTTCAGTCCC
TCGTCAACCTGATGGACTCGTCCTCGCCCAAGGTTCAATGCCAGGCCGCCTTGGCCCTGCGAAACCTGGCATCCG
ACGAGAAATACCAGCTCGACATTGTGCGGGCCAACGGCCTCCACCCCCTCCTCCGCCTTCTCCAGTCGTCCTATC
TTCCCCTCATTCTCTCGGCCGTCGCCTGCATACGAAACATCTCCATCCACCCCATGAATGAGTCGCCCATTATCG
AGGCCAACTTCCTGAAGCCCTTGGTTGACCTCCTCGGATCGACAGACAACGAGGAGATCCAGTGCCATGCCATTT
CCACTCTGCGCAACCTGGCCGCCAGCTCCGACCGGAACAAGGCGCTCGTGCTGGACGCGGGGGCCGTGCAAAAGT
GCAAGCAATTGGTGCTCGACGTCCCCGTCACTGTCCAGTCGGAAATGACGGCGGCCATCGCGGTCCTTGCACTGA
GCGACGACCTCAAGTCGCATCTCCTCAACCTGGGTGTCTGCGATGTTCTCATCCCTCTGACCCACTCACCCAGCA
TCGAGGTCCAGGGCAACAGCGCCGCCGCCCTGGGCAACCTCTCATCCAAAGGTCTGTGCTGCCCTGTTGGCATCT
TATGGGACCACGTGCTGACCGGTGGACTGCAGTCGGCGACTACTCTATCTTTGTGCAAAATTGGACCGAGCCCGG
CGGCGGCATCCACGGCTACCTCGGACGCTTCCTGCAATCTGGCGACGCCACCTTTCAGCACATTGCCGTCTGGAC
GCTGCTTCAGCTTTTCGAATCCGAAGACAAGACGTTGATCGGACTCATCGGCAAGGCCGACGACATTATCGAGCA
CATCCGGAACATTGCGAACCGGCAGGTGGAGACGGAGCCAGACTTTGAAGAGGACGAGGGCGAAGTGGTCAATCT
GGCGCAGCGGTGCCTCGAGCTTTTGGGACAGAGTATGTCGAAGGCTCATATCGAGGGCTAGACTTGCAGCTTTTG
GCTGCCGTGGCGGCCGAGTACTAATTGCTTCCAAGTGAACGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail